KEGG   Mycobacterium tuberculosis H37Rv: RVBD_2215Help
Entry
RVBD_2215         CDS       T02178                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase DlaT
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RVBD_2215
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RVBD_2215
  Amino acid metabolism
   00310 Lysine degradation
    RVBD_2215
Enzymes [BR:mtv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RVBD_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2481973..2483634
Genome map
AA seq 553 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVIRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAGAAEG
APYVTPLVRKLASENNIDLAGVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAAAAPA
PKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGLRARA
KAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVDTEQG
LLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPIL
VPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKH
RLEEGAFEADLGL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcccctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcattcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcacccaagcccgtccccgagccagcgccgacg
ccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggtgcggccgagggc
gcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaacatcgacctcgcc
ggggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtgctggccgcggct
gagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgccgccgcgccggcc
ccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggcaccacccagaag
gccagccggattcgtcagatcaccgccaacaagacccgcgaatctttgcaggcaacggca
cagctgacacaaacccatgaggtcgacatgaccaagatcgtggggctacgggcccgggcc
aaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccgttcttcgccaag
gccgtgatcgatgccctcaagattcacccgaacatcaacgctagctacaacgaggacacc
aaggagatcacctactacgacgccgagcacctaggattcgctgtcgacaccgagcagggc
ctgctctccccggtcatccacgacgccggcgatctgtcactggccggtctggcgcgggcg
atcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgacgagttgtccggc
ggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgacaccccgatcctg
gttccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcggccgcgggtggtc
gtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctacctcccgttgacc
tatgaccatcggctcatcgacggcgccgacgccggacgtttcctcaccacgatcaagcac
cgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system