KEGG   Mycobacterium tuberculosis H37Rv: RVBD_2740Help
Entry
RVBD_2740         CDS       T02178                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mtv00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3053243..3053692
Genome map
AA seq 149 aa AA seqDB search
MAELTETSPETPETTEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRT
ATLLRRMQGRVGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFEVDDGRITLW
RDYFDVYDMFKGLLRGLVALVVPSLKATL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgaaacatcgccggaaacccccgaaaccaccgaggccattcgtgcc
gtcgaggcgttcctcaacgccctgcagaacgaagacttcgacaccgtcgacgccgcactg
ggcgacgacctggtctatgagaacgtcgggttttccaggatccgcggtggccgccgcacg
gcaacgctgcttcgccgcatgcagggccgcgtcggcttcgaggtgaagatccaccgcatc
ggcgccgacggcgccgcggtgctcaccgaacgcaccgacgcgctaatcatcggaccgctg
cgggtgcagttctgggtctgcggcgtattcgaggtggacgatgggcggatcaccctgtgg
cgggactacttcgatgtctacgacatgttcaagggcctcttgcgaggcctggtggcgctg
gtggtgccatcgctgaaggcaacgctgtag

DBGET integrated database retrieval system