KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3317Help
Entry
RVBD_3317         CDS       T02178                                 

Definition
(GenBank) succinate dehydrogenase [hydrophobic membrane anchor subunit] SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00020  Citrate cycle (TCA cycle)
mtv00190  Oxidative phosphorylation
mtv00650  Butanoate metabolism
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
mtv01130  Biosynthesis of antibiotics
mtv01200  Carbon metabolism
Module
mtv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RVBD_3317
   00650 Butanoate metabolism
    RVBD_3317
  Energy metabolism
   00190 Oxidative phosphorylation
    RVBD_3317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFN51325
UniProt: A0A089QUP5 O53369
Position
3704608..3705042
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHVFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacgtgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system