KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3374Help
Entry
RVBD_3374         CDS       T02178                                 

Definition
(GenBank) enoyl-CoA hydratase EchA18.1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00071  Fatty acid degradation
mtv00280  Valine, leucine and isoleucine degradation
mtv00281  Geraniol degradation
mtv00310  Lysine degradation
mtv00360  Phenylalanine metabolism
mtv00362  Benzoate degradation
mtv00380  Tryptophan metabolism
mtv00410  beta-Alanine metabolism
mtv00627  Aminobenzoate degradation
mtv00640  Propanoate metabolism
mtv00650  Butanoate metabolism
mtv00903  Limonene and pinene degradation
mtv00930  Caprolactam degradation
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
mtv01130  Biosynthesis of antibiotics
mtv01212  Fatty acid metabolism
Module
mtv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RVBD_3374
   00650 Butanoate metabolism
    RVBD_3374
  Lipid metabolism
   00071 Fatty acid degradation
    RVBD_3374
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVBD_3374
   00310 Lysine degradation
    RVBD_3374
   00360 Phenylalanine metabolism
    RVBD_3374
   00380 Tryptophan metabolism
    RVBD_3374
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RVBD_3374
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RVBD_3374
   00281 Geraniol degradation
    RVBD_3374
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RVBD_3374
   00627 Aminobenzoate degradation
    RVBD_3374
   00930 Caprolactam degradation
    RVBD_3374
Enzymes [BR:mtv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RVBD_3374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1
Motif
Other DBs
NCBI-ProteinID: AFN51386
UniProt: A0A089QS66 Q6MWX6
Position
3788548..3788796
Genome map
AA seq 82 aa AA seqDB search
MVQKVVAPQDLAAATAKLVGQVCRQSAVTMRAAKVVANMHGRALTGADTDALIRFGVEAY
EGADLREGVAAFSQGRPPKFDD
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
ttggtgcaaaaggtcgtcgcaccacaggatttggcggccgcgacggccaaactggtcggc
caggtctgtcggcaatccgcggtgaccatgcgtgcggcgaaggtggtcgccaacatgcac
ggccgagcgctgaccggcgccgacaccgatgcgctgatccggttcggtgtcgaagcctac
gagggggcggacctacgcgaaggggtggcggccttcagccagggacgcccacccaaattt
gatgattag

DBGET integrated database retrieval system