KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3516Help
Entry
RVBD_3516         CDS       T02178                                 

Definition
enoyl-CoA hydratase EchA19
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RVBD_3516
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RVBD_3516
   00650 Butanoate metabolism
    RVBD_3516
  Lipid metabolism
   00071 Fatty acid degradation
    RVBD_3516
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVBD_3516
   00310 Lysine degradation
    RVBD_3516
   00360 Phenylalanine metabolism
    RVBD_3516
   00380 Tryptophan metabolism
    RVBD_3516
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RVBD_3516
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RVBD_3516
   00281 Geraniol degradation
    RVBD_3516
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RVBD_3516
   00627 Aminobenzoate degradation
    RVBD_3516
   00930 Caprolactam degradation
    RVBD_3516
Enzymes [BR:mtv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RVBD_3516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3952723..3953514
Genome map
AA seq 263 aa AA seqDB search
MESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCILTGAGG
YFCAGMDLKAATQKPPGDSFKDGSYGPSRIDALLKGRRLTKPLIAAVEGPAIAGGTEILQ
GTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAAEAKEMG
LIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQIGIKVF
LSDDAKEGPRAFAEKRAPNFQNR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtggaatccggacccgacgcgctggtggagcggcgcggccacaccctgatcgtgaccatg
aaccggccggccgcccgcaacgcgctgagcaccgaaatgatgcgaatcatggtgcaggcc
tgggatcgcgtcgacaacgatcccgacatccgttgctgcatcctcaccggagccggtggc
tacttttgcgccggcatggacctcaaggcggcaacccagaaaccgccgggcgactctttc
aaggacggcagctacggcccgtcgcgcatcgatgccctgctcaaagggcgccgcttgacc
aaaccgctgatcgccgccgtcgaggggcccgcgatcgccggcggcaccgagatcctgcag
ggcaccgacatccgggtcgccggtgaaagtgcgaagttcggcatctccgaggccaagtgg
agcctgtacccgatgggcggctcggccgtgcggctggtccggcagatcccctacactctg
gcctgcgacctgctgctgaccggacggcacattaccgccgccgaggccaaggaaatgggc
ctgatcggccacgtggtgcccgacggccaggcgctgaccaaggctctagaacttgccgac
gccatctcggctaacggacccctggccgtgcaggccatcctgcggtccatccgcgagacc
gagtgcatgcccgaaaacgaggcgttcaagatcgacacccagatcggcatcaaggtcttc
ctgtccgacgacgccaaggaaggcccgcgcgcgttcgccgagaagcgcgcacccaacttc
cagaaccgctag

DBGET integrated database retrieval system