KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3667Help
Entry
RVBD_3667         CDS       T02178                                 

Definition
acetyl-CoA synthetase Acs
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RVBD_3667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RVBD_3667
   00620 Pyruvate metabolism
    RVBD_3667
   00640 Propanoate metabolism
    RVBD_3667
  Energy metabolism
   00680 Methane metabolism
    RVBD_3667
Enzymes [BR:mtv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RVBD_3667
Lipid biosynthesis proteins [BR:mtv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RVBD_3667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4107970..4109925
Genome map
AA seq 651 aa AA seqDB search
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWS
GAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAK
LLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVV
GSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDV
FWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTL
IRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGS
AMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSML
RGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEV
ESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIAR
PRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtccacccccgaagtctcctcgtcatacccgccgccagcgcacttcgccgag
cacgcgaacgcccgcgccgagctttaccgcgaggccgaggaagaccggctggctttttgg
gccaagcaggccaaccgactgtcctggacgacgccgttcaccgaggtgttggactggtcg
ggggcgccgttcgccaagtggttcgtgggcggcgagctcaacgtcgcctacaactgtgtg
gatcgtcacgtcgaggccggccatggagatcgggtcgccatccactgggaaggcgagccg
gtcggcgaccggcgcacgctgacctattccgatctgcttgccgaggtatccaaagccgcg
aacgcgctcaccgacctcggtctggtggccggtgaccgcgtcgccatctacctgccgttg
atccctgaggccgtgatcgccatgctggcctgtgcccggctaggcatcatgcatagcgtt
gttttcggcgggttcaccgctgcggccttgcaggcccggatcgtcgacgcccaagccaag
ctgctgatcaccgcggacgggcagtttcggcgcggcaagccatcgcccctcaaggcggcc
gctgacgaggcccttgcagcgatccccgactgctcggtcgagcacgttctggtggtgcgg
cgcacgggaattgagatggcctggagcgagggccgcgacctgtggtggcaccatgtcgtc
ggctcagcttcaccggcacacaccccggagcctttcgattccgagcacccgctgttcctg
ctgtacacgtcaggcaccaccggcaagcccaaaggcattatgcacaccagcggcggctat
ctcactcagtgttgctacacgatgcgcaccattttcgatgtcaagccggacagcgacgtg
ttctggtgcaccgccgacatcggctgggtcaccggccacacctacggcgtctacggcccg
ctgtgcaacggagtcaccgaggttctctacgagggcacgccggatacccccgaccgacac
cggcatttccagatcatcgaaaaatacggcgtgacaatctattacaccgcccccaccctc
atccggatgtttatgaagtggggccgtgagatccccgacagccacgacctgtccagcctg
cggctgctggggtcggtcggcgaaccgatcaaccccgaggcttggcgttggtaccgcgat
gtcatcggcggcggacgcaccccgctggtagacacctggtggcagaccgagaccggctcc
gcgatgatctccccgctgcccggaatcgctgcggccaaaccgggttcagcgatgacgccg
ctgcccgggatctcggccaagatcgtcgacgatcacggtgatccgttgccaccgcacacc
gagggcgcccagcatgttaccgggtacctcgtcctagaccagccgtggccgtcgatgttg
cgcggcatctggggcgaccccgcgcggtattggcactcttactggtccaaattttccgac
aagggctactacttcgccggggacggcgctcgcatagaccccgacggcgcgatctgggta
ctaggccgcatcgacgacgtgatgaacgtgtccgggcaccggatctcgaccgccgaggtg
gaatcggcgctggtcgctcactctggcgtggccgaggcggcggtggtcggggttaccgac
gagaccacgacccaggccatctgtgcgttcgtcgtgctacgcgccaactacgccccccat
gaccgcacagccgaagagttgcgcaccgaagtggctcgagtgatctcgcccatcgcacgg
ccacgcgacgtccacgtagtgcccgaactacccaagactcgtagcggcaaaatcatgcgt
cgactgctgcgcgacgtcgcggaaaaccgtgagcttggcgacacgtcgacgctgctcgat
cccaccgtattcgacgcgatccgggccgccaagtag

DBGET integrated database retrieval system