KEGG   Mycobacterium tuberculosis EAI5: M943_00695Help
Entry
M943_00695        CDS       T02749                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
152328..154133
Genome map
AA seq 601 aa AA seqDB search
MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFKHAVFYEVLVRAFFDA
SADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFV
ALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDYYVWSDTSERYTDARIIF
VDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDAV
PYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPGDVVEYFGDPNTGGD
ECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMAQWGIFLRNHDELTLEMVTDE
ERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDEIGM
GDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPPSQDPVYGYQAVNVEAQRDTSTS
LLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYVRQVAGDDGDTVLCVNNLSRFPQP
IELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPGHGFYWFQLTTHEVGAPPTCGGERR
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaacacagcgtcgagcaccctcccgtgcagggcagtcacgtcgaaggc
ggtgtggtcgagcatccggatgccaaggacttcggcagcgccgccgccctgcccgccgat
ccgacctggtttaagcacgccgtcttctacgaggtgctggtccgggcgttcttcgacgcc
agcgcggacggttccggcgatctgcgtggactcatcgatcgcctcgactacctgcagtgg
cttggcatcgactgcatctggttgccgccgttctacgactcgccgctgcgcgacggcggt
tacgacattcgcgacttctacaaggtgctgcccgaattcggcaccgtcgacgatttcgtc
gccctggtcgacgccgctcaccggcgaggtatccgcatcatcaccgacctggtgatgaat
cacacctcggagtcgcacccctggtttcaggagtcccgccgcgacccagacggaccgtac
ggtgactattacgtgtggagcgacaccagcgagcgctacaccgacgcccggatcatcttc
gtcgacaccgaagagtcgaactggtcattcgatcctgtccgccgacagttctactggcac
cgattcttctcccaccaaccggatctgaactacgacaaccccgccgtgcaagaggcgatg
atcgacgtcatccgcttttggctcggcttgggcatcgacgggtttcggttggacgcggtg
ccctatctctttgaacgtgagggcaccaactgcgagaacctgccggaaacacacgctttt
ctcaagcgagtccgcaaggtggtggacgacgaattccccggccgggtgctgctagccgaa
gccaatcagtggccgggcgatgtcgtcgaatatttcggtgatcccaacaccggtggcgac
gagtgccacatggcctttcacttcccgctgatgccgcgcatcttcatggccgtgcgccgg
gagtcccgttttccgatctcggagatcatcgcccagaccccaccaatccctgacatggcg
caatgggggatatttctgcgcaaccacgacgagctgacgttagaaatggtcaccgacgaa
gagcgcgactacatgtacgccgagtacgccaaggatccacggatgaaggcgaatgtcgga
atccgtcgtcggcttgcgccgctgctcgacaacgaccgcaaccagatcgagctgttcacc
gcgctgctgctgtcgctgcccggctcgccggtcctctactacggcgacgagatcgggatg
ggcgacgtgatctggttgggtgatcgcgacggcgtgcgcatcccgatgcagtggacaccg
gaccgcaacgcgggtttctccaccgccaacccgggtcggctgtacctgccgcccagccag
gacccggtttacgggtatcaggccgtcaacgtcgaggcgcaacgcgacacctcgacgtcg
ctgctcaacttcactcgcaccatgctggccgtgcgtcgccgacaccccgcgtttgcggtc
ggcgcattccaggaattgggcgggtccaacccgtcggtgctggcctacgtgcgtcaggtg
gccggcgatgacggcgacaccgtgctctgtgtcaacaacctgtcgcgattcccgcagccc
atcgaattggacttgcagcaatggaccaactacacgccggtcgagctgaccgggcacgtg
gagtttccacgcatcggccaggtgccctatctgctgacgctgccaggacacgggttctac
tggttccagttgaccacacatgaggtgggggcacctcccacttgcgggggagagcggcgc
ctatga

DBGET integrated database retrieval system