KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000240Help
Entry
TBXG_000240       CDS       T02141                                 

Definition
lipoprotein LpqI
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TBXG_000240
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TBXG_000240
Enzymes [BR:mtz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TBXG_000240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287126..288292
Genome map
AA seq 388 aa AA seqDB search
MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPVPRSCAEPAGIPALLS
PRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDGALAEIVAGGGPLPLAV
SVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRGRQMRKLGITIDFAPVVD
VTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVLKHFPGHGRGSGDSHNGGV
TTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSEPASLSKAAVNLLRTGTGYG
APPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIALWVTTKEVPAVLDRLEQALR
AGELPMSAVDRSVVRVATMKGPNPGCGR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccacgcacactggcgatactcgctgcggcagcagcgttggtggtggcctgc
agccatggcggcacacccaccggatcgtcgacgacctccggcgcgtcgcccgcaactccg
gtagccgttcccgtgccccggagctgcgccgagccggcggggatcccggcgctgctgtcc
ccccgtgacaagctggcccagctgctggtggtcggcgtgcgagatgctgcggacgcccaa
gccgtggtcaccaactaccacgtcggcggcatcctcatcggcagcgacaccgacctgacg
atttttgacggcgcgctggccgagatcgttgccggcgggggtccgctgccgctggcggtg
agtgtcgacgaggaaggcgggcgggtgtcccggttgaggtcgctgatcggcggtacgggg
ccgtcggcccgcgaactggcacaaacccgaaccgtccagcaggtgcgcgacttggctcga
gaccgcggccggcagatgagaaagctgggtatcaccatcgacttcgccccggtggtcgac
gtcaccgacgccccggatgacacggtgatcggggaccggtcgttcggctcggatccggct
acggtcaccgcgtatgccggggcgtacgcgcagggtctgcgcgatgccggggtgctgccg
gtgctcaagcatttccccggtcacgggcgtggctcgggtgattcgcacaacgggggtgtc
acgacaccaccgcttgatgacctggtgggcgatgacctggtgccctaccgaacgctggtg
acccaggcgccggtcggtgtgatggtgggtcatctgcaggttcctgggttgaccggctcc
gagccggccagtctgagcaaggccgcggtgaacctgctgcgcaccggcacgggatacggc
gcaccgccgttcgatggtccagtgttcagcgacgacctctctggtatggccgcgatctca
gaccggtttggcgtcagcgaggcggtgttgcgcaccttgcaagccggtgccgatatcgca
ctgtgggttaccaccaaagaggtgcccgcggtgctggaccgcctggaacaggcgctgcgc
gccggtgaattgccgatgtcggcggtcgaccggtcggtggtgcgggtggcgaccatgaag
gggcccaacccggggtgtggccgttag

DBGET integrated database retrieval system