KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000467Help
Entry
TBXG_000467       CDS       T02141                                 

Definition
(GenBank) isocitrate lyase icl
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00630  Glyoxylate and dicarboxylate metabolism
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01120  Microbial metabolism in diverse environments
mtz01200  Carbon metabolism
Module
mtz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TBXG_000467
Enzymes [BR:mtz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TBXG_000467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: AFM47851
Structure
PDB: 

Jmol
Position
557787..559073
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgtcggcaccccgaagagcgcggagcagatccagcaggaatgggacacgaac
ccgcgctggaaggacgtcacccgcacctactccgccgaggacgtcgtcgccctccagggc
agcgtggtcgaggagcacacgctggcccgccgcggtgcggaggtgctgtgggagcagctg
cacgacctcgagtgggtcaacgcgctgggcgcgctgaccggcaacatggccgtccagcag
gtgcgcgccggcctgaaggccatctacctgtcgggctggcaggtcgccggcgatgccaac
ctgtccgggcacacctaccccgaccagagcctgtatcccgccaactcggtgccgcaggtg
gtccgccggatcaacaacgcactgcagcgcgccgaccagatcgccaagatcgagggcgat
acttcggtggagaactggctggcgccgattgtcgccgacggcgaggccggctttggcggc
gcgctcaacgtctacgagctgcagaaagccctgatcgccgcgggcgttgcgggttcgcac
tgggaggaccagttggcctctgagaagaagtgcggccacctgggcggcaaggtgttgatc
ccgacccagcagcacatccgcactttgacgtctgctcggctcgcggccgatgtggctgat
gttcccacggtggtgatcgcccgtaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggcgagcgcacccgggaaggcttctaccgc
accaagaacggcatcgagccttgcatcgctcgggcgaaggcctacgccccgttcgccgac
ttgatctggatggagaccggtaccccggacctcgaggccgcccggcagttctccgaggcg
gtcaaggcggagtacccggaccagatgctggcctacaactgctcgccatcgttcaactgg
aaaaagcacctcgatgacgccaccatcgccaagttccagaaggagctggcagccatgggc
ttcaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttcgat
ctggcctacggctacgcccagaaccagatgagcgcgtatgtcgaactgcaggaacgcgag
ttcgccgccgaagaacggggctacaccgcgaccaagcaccagcgcgaggtcggcgccggc
tacttcgaccggattgccaccaccgtggacccgaattcgtcgaccaccgcgttgaccggt
tccaccgaagagggccagttccactag

DBGET integrated database retrieval system