KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000490Help
Entry
TBXG_000490       CDS       T02141                                 

Definition
(RefSeq) phosphoglycerate mutase 1 gpm1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBXG_000490
   01230 Biosynthesis of amino acids
    TBXG_000490
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBXG_000490
  Energy metabolism
   00680 Methane metabolism
    TBXG_000490
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBXG_000490
Enzymes [BR:mtz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TBXG_000490
Exosome [BR:mtz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TBXG_000490
  Exosomal proteins of melanoma cells
   TBXG_000490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
578686..579435
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system