KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000490Help
Entry
TBXG_000490       CDS       T02141                                 

Definition
(GenBank) phosphoglycerate mutase 1 gpm1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00010  Glycolysis / Gluconeogenesis
mtz00260  Glycine, serine and threonine metabolism
mtz00680  Methane metabolism
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01120  Microbial metabolism in diverse environments
mtz01130  Biosynthesis of antibiotics
mtz01200  Carbon metabolism
mtz01230  Biosynthesis of amino acids
Module
mtz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtz_M00002  Glycolysis, core module involving three-carbon compounds
mtz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBXG_000490
  Energy metabolism
   00680 Methane metabolism
    TBXG_000490
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBXG_000490
Enzymes [BR:mtz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TBXG_000490
Membrane trafficking [BR:mtz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TBXG_000490
Exosome [BR:mtz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TBXG_000490
  Exosomal proteins of melanoma cells
   TBXG_000490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFM47874
Structure
PDB: 

Jmol
Position
578686..579435
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system