KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000516Help
Entry
TBXG_000516       CDS       T02141                                 

Definition
delta-aminolevulinic acid dehydratase hemB
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBXG_000516
Enzymes [BR:mtz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TBXG_000516
Exosome [BR:mtz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBXG_000516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604838..605827
Genome map
AA seq 329 aa AA seqDB search
MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPITSMPGVVQHT
RDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGILNVALRDLAKDLGEATV
LMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAESGAHVVGPSGMMDGQVA
AIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREI
ELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAA
VLESLTGIRRAGADIVLTYWAVDAAGWLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagttcctatccgcggcagcgaccgcgccggctccgctccaccgtcgcgatg
cgccgtctggttgcgcaaacctcgttggagccaaggcatttggtgctgccgatgttcgtt
gccgacggcattgacgagccgcggccgattacctccatgccgggcgtggtacagcacacc
cgggattcgctacgtagggccgcggcagccgcggtggccgccggcgtgggtgggctgatg
cttttcggcgtgccgcgcgaccaggacaaggacggtgtcggttcggcgggcatcgacccc
gacgggatcctcaacgtcgcccttcgcgatctggccaaggacctgggtgaggccacggtg
ttgatggccgacacctgtctggacgagttcaccgaccacgggcactgcggtgtgctcgat
gaccggggccgggtcgataacgacgccaccgtggcccgctatgtggaactggctgtggcg
caagcggaatcgggcgcccacgtggtcggacccagtgggatgatggatggccaggtagcc
gcgatccgggacggtttggacgccgccggctacatcgatgtggtgatcttggcctacgcc
gcgaagtttgcttcggcgttctacggcccgttccgcgaggcggtgagctctagcctgtcc
ggggatcggcgcacctaccagcaggagccgggcaacgccgccgaggcgctgcgtgagatc
gagctcgatctcgacgaaggcgccgacattgtgatggtcaaacccgcgatgggctacctc
gatgtggtggcggccgcggcggacgtctcgccggtcccggtggccgcctatcaggtctcg
ggagagtacgcgatgattcgtgcggcggcggccaataattggatcgatgagcgtgccgcg
gtgctagagtcgctgaccggtatccggcgtgccggcgccgacatcgtgctcacctactgg
gcggtagacgcggcgggctggcttacgtga

DBGET integrated database retrieval system