KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000631Help
Entry
TBXG_000631       CDS       T02141                                 

Definition
exonuclease subunit V alpha recD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TBXG_000631
Enzymes [BR:mtz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TBXG_000631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720316..722043)
Genome map
AA seq 575 aa AA seqDB search
MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA
GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE
EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTV
ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT
LHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSG
EERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVL
HWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISG
ASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKR
KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaccgacgtcgattttgccgtcgaggcctccgggatggtgcgggccttcaac
caggccggtgtgctggacgtgtcggatgtgcatgtggcgcaacgtctctgtgcactggcc
ggggagagcgacgagcgggtggcgttggcggtagcggtggcggtccgcgcgctacgggcc
ggttcggtgtgtgtggatctgttgtcgatcgcgcgggttgctggacacgacgacctgccg
tggccggatccggcggactggttggcggcggtgcgggccagtccgttgctcgccgatcca
cccgtgctgcacctgtatgacgatcggctgctctatctggaccgctactggcgcgaagaa
gagcaggtgtgcgcggacctgctcgcgttgctgacatccaggcgaccggccggggtaccc
gacttgcggcgactgttcccgaccggctttgacgagcagcggcgcgcggcggaaatcgcg
ctctcgcaaggtgttacggtgttgactggcgggcctggcaccgggaagacgacgacggtc
gcgcggctgctggcgttggttgccgagcaggcggagctggccggtgagccgcggccgcgg
atcgcgctggccgcacccaccggcaaggcggcggcccggctggccgaggcggtacggcgc
gagatggccaagctcgacgccaccgaccgggcacggctcggcgacctgcacgcggtcacg
ctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgccaggatcgccagaaccgg
ttgcctcacaacgtgatcgtggtcgacgagacctcgatggtgtcgctgacgctgatggcc
cggctggccgaggcggtgcgcccgggcgcccggttgatcctcgtcggcgatgccgaccag
ttggcgtcggtggaagccggagcggtgctggcggatttggtcgatggcttctcggtacgc
gacgacgcgctggtggcgcagctgcgaacgtcgcatcggttcggcaaggtgatcggtacc
ttggccgaagcgatccgggccggcgatggcgatgccgtactgggcctgctgcgctcgggt
gaggagcggatcgagttcgtcgacgacgaggatccggcgccgcggttgcgcgcggtgctg
gtgccacacgcgttgcggctgcgcgaggcggcgctgttgggtgcctccgacgtcgcgttg
gccaccctggacgagcaccggctgctgtgtgcgcatcgggacgggcccaccggcgtgctg
cactggaaccgccgggttcaagcctggctcgccgaggagaccggccagccgccctggacg
ccgtggtacgccgggcgtccgctgctggtgacggccaacgactacggccttcgcgtctac
aacggcgacaccggtgtcgtgctggccggccccaccggtctgcgggccgtcatttctggt
gcatccgggccacttgacgttgccaccggccgcctcggcgacgtcgagaccatgcacgcg
atgaccatccacaagagtcagggcagccaggtcgacgaggtgacggtgctgatgccgcaa
gaggattcgcggttgctgacccgggagttgctgtacaccgcggtgacccgggccaaacgc
aaggtccgggtggtcgggtccgaagcttcggtgcgggccgcgatcgcacgccgggcggtg
cgggccagcgggttgcggatgcggttacagtcgacggggtgtggctga

DBGET integrated database retrieval system