KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000654Help
Entry
TBXG_000654       CDS       T02141                                 

Definition
(GenBank) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00010  Glycolysis / Gluconeogenesis
mtz00052  Galactose metabolism
mtz00500  Starch and sucrose metabolism
mtz00520  Amino sugar and nucleotide sugar metabolism
mtz00521  Streptomycin biosynthesis
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01120  Microbial metabolism in diverse environments
mtz01130  Biosynthesis of antibiotics
mtz01200  Carbon metabolism
Module
mtz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBXG_000654
   00052 Galactose metabolism
    TBXG_000654
   00500 Starch and sucrose metabolism
    TBXG_000654
   00520 Amino sugar and nucleotide sugar metabolism
    TBXG_000654
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TBXG_000654
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TBXG_000654
Enzymes [BR:mtz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TBXG_000654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFM48044
Position
747881..748789
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAV
CDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctttgcctcgacatcggcggcaccaagatcgccgcgggcctggccgacccg
gccggcacgttggtgcacaccgcccaacgtcccaccccggcgtatggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgcggtc
ggtggtgtggggatcgcctcggccggtcctatcgacctacacagcggccgcgtcagcccg
atcaacatcggatcctggggcggctttccgctgcgggatcgggtcgccgccgcggtcccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggctg
ggagccggacggggtgcgcgctttctgttgggtttggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctgtctcggccgcaccggcaacgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgtggctgtgtggag
accatcgcgtccggcccgtcgctggcgcgctgggcgcgggccaacggctggtccgcgccg
cccggggccggcgccaaagagctggccgaggcggctggggccggagacccggtggcgctg
cgggccttccgccgcggcgccgcggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacttggatctcgccgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcctgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atcgcataa

DBGET integrated database retrieval system