KEGG   Mycobacterium tuberculosis KZN 605: TBXG_001287Help
Entry
TBXG_001287       CDS       T02141                                 

Definition
protoporphyrinogen oxidase hemY
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBXG_001287
Enzymes [BR:mtz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TBXG_001287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421238..1422596
Genome map
AA seq 452 aa AA seqDB search
MTPRSYCVVGGGISGLTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAE
AFVLRRPEMPALLAELGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLV
DDATLARIDAEAARPFTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGL
RAAAPSVAAALDRGATSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRA
RVVQLERGWVLRDETGGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVA
LAVPGGTAFPHCSGVLVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTAS
DDQLLAWAADDLVTVFGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAG
SYLDGIGVPACVGAAGRAVTSVIEALDAQVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactccccgctcgtattgtgttgtaggaggcgggatttcgggattgacctcggcgtac
cggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttcgaaccggccgatagg
ctcggcggggtattgcgcaccgagcatatcggcggacagccaatggacctcggcgcggag
gcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgagctgggcctgtcggac
cgccaactcgccagcaccggcgcgcggccgctcatctacagccagcagcgcttgcacccg
ctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctccatggcggggctggtc
gacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccgttcacctggcaggtg
ggcagcgatcccgcggtggccgacttggtggctgaccggttcggcgaccaagtcgtggcc
cggtcggtggacccgctgttaagcggggtatacgcgggctcggcggcgacgatcgggctg
cgcgcggccgccccgagcgtggccgcggccctggatcgcggggcgaccagtgtgaccgac
gcggtccggcaggcgctgccgccgggaagcggcgggccggtgttcggcgcgctggacggc
gggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtgcactgggtgcgggcc
agggtggtccagctcgaacgcggctgggtgctgcgcgacgaaaccggcggccgctggcag
gccgacgccgtcatcctggcggttccggcgccgcggttggcgcgcctcgtcgatggcatc
gcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcgtcggcggtggtggcg
ctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtgctggtggccggcgac
gagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatggggtcagcgcggcgac
gtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccggccctgacggcctcc
gacgaccaactcctggcctgggcagcggacgacttggtcacggtgttcggtgtggccgtc
gacccggtcgacgttcgggtccggcgctggatcgaggcgatgccgcagtacggtcccggc
catgccgatgtggtcgccgagctgcgcgccggcctgccaccgacgctggccgttgcgggc
agctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcgggccgggccgtcacc
agcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system