KEGG   Mycobacterium tuberculosis KZN 605: TBXG_001805Help
Entry
TBXG_001805       CDS       T02141                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelat E ligase MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mtz00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mtz00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1994685..1996292
Genome map
AA seq 535 aa AA seqDB search
MSSLARGISRRRTEVATQVEAAPTGLRPNAVVGVRLAALADQVGAALAEGPAQRAVTEDR
TVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVLTDPAGVAEIAGRAAVP
VLVHPAPRGVLGGLAATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRAAGRVAGLIGT
IGIRVGGADLPSALTTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGA
FTNLSRDHLDFHPSMADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARAADAITVS
AADRPAHWRATDVAPTDAGGQQFTAIDPAGVGHHIGIRLPGRYNVANCLVALAILDTVGV
SPEQAVPGLREIRVPGRLEQIDRGQGFLALVDYAHKPEALRSVLTTLAHPDRRLAVVFGA
GGDRDPGKRAPMGRIAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIAD
RRDAIRHAVAWARPGDVVLIAGKGHETGQRGGGRVRPFDDRVELAAALEALERRA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgctggcccgagggatctcgcggcggcgaacggaggtggcgacacaggtggag
gctgcgcccactggcttgcgccccaacgccgtcgtgggcgttcggttggccgcactggcc
gatcaggtcggcgcggccctggccgagggtccagctcagcgtgccgtcaccgaggaccgg
acggtcaccggggtcacgctgcgcgcccaggacgtgtcacccggtgacctgttcgccgcc
ctgaccggctcgaccacccacggggcccgccacgtcggcgacgcgatcgcacgcggcgcc
gtcgcggtgctcaccgaccccgccggggtcgccgagatcgccggacgagcggccgtgccc
gtgttggtgcaccccgcaccccgcggcgtgctcggcggcttggccgccaccgtgtacggg
catccgtccgagcggttgacggttatcgggatcaccggaacgtccggcaagaccaccacc
acctatctggtcgaggccgggttacgggctgccggacgcgtcgccgggctgatcggcacc
atcggcatccgcgtcggcggcgccgaccttcccagcgcgctgaccaccccggaggccccc
acgctgcaggcgatgctggcggcgatggtcgaacgcggggtggacaccgtggtcatggag
gtgtccagccacgcgctggcgctgggccgggtggacggcacccggttcgccgtcggcgcc
ttcaccaatctctcccgtgaccacctggatttccaccccagcatggccgactacttcgag
gccaaggcgtcattgttcgatccggactcggcactgcgcgcccgcaccgccgtggtgtgc
atcgacgacgacgccgggcgcgcgatggcggcgcgggccgccgacgcgatcaccgtcagc
gccgccgaccggcccgcacactggcgcgccacggatgtggcgcccacggacgcgggcggg
caacaattcaccgccatcgaccccgccggcgtagggcatcacatcggaatccggctaccg
ggccgctacaacgtcgccaattgcctggtcgccctggcgattctggacaccgtcggggtc
tccccggaacaggcggtgccgggcctgcgtgagatccgggtcccggggcggctcgagcag
atcgaccgcggccagggctttctcgcgctggtcgactacgcgcacaaaccggaagcgctg
cggtcggtgctgaccaccttggcgcacccggaccgccggctggcggtggtgttcggcgcc
ggcggcgatcgtgacccgggcaagcgggccccgatgggccggatagccgcgcagctggcc
gacttggtggtcgtcaccgacgacaacccgcgtgacgaagatcccacggcgatccgccgc
gaaatcctggctggggcggccgaagtcggcggtgatgcccaggtcgtcgagatcgcagac
cggcgggacgcgatccggcacgcggttgcctgggcgcgccccggcgacgtggtgctcatc
gccggcaaaggccacgagaccgggcaacgcggcggcgggcgggtccgcccgttcgacgac
cgggtggagctggctgccgcgctagaggccctcgagcggcgcgcatga

DBGET integrated database retrieval system