KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002196Help
Entry
TBXG_002196       CDS       T02141                                 

Definition
4-alpha-glucanotransferase malQ
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2406633..2408807
Genome map
AA seq 724 aa AA seqDB search
MTELAPSLVELARRFGIATEYTDWTGRQVLVSEATLVAALAALGVPAQTEQQRNDALAAQ
LRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQLEDGTTRAEVVQVDNFTPPFDL
DGRWIGEASFVLPADLPLGYHRVNLRSGDSQASAAVVVTPDWLGLPDKLAGRRAWGLAVQ
LYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPSPYL
PTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRAALK
LVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAETYGDDWHRWPKSLRHPDASGVAD
FVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLGIMADLAVGVHPNGADAWALQDV
LAQGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEQEYRPFRALIQAALRHAGAVRIDHIIG
LFRLWWIPDGAPPTQGTYVRYDHDAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLR
GLLGTSILWFEQDRDCGPAGTPLPAERWREYCLSSVTTHDLPPTAGYLAGDQVRLRESLG
LLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDSEEAVLALYRYLGRTPSRLLAVA
LTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPMLLEDIFTDRRAATLAEAVRAATTSP
MSCW
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgcgccttcgctggtcgaacttgcccgacgattcggcattgccaccgag
tacacggactggactggccggcaggtgctggtctccgaggctacattggtggctgctctt
gccgccctcggcgttcccgcccagaccgaacagcaacgcaatgacgccctggccgcgcag
ctgcgatcctactgggcgcgtccattgccggcgaccatcgtcatgcgcgccggagagcag
acgcagttcagggtgcatgtgaccgatggcgctccggccgacgtgtggttgcagctcgag
gacggcacgacacgtgccgaggtggtgcaggtcgacaatttcaccccgccattcgatctt
gacggacgctggatcggcgaggccagcttcgtgttgcccgccgacctgcccctcggctac
caccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtcgtgacgccg
gattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctggccgtccag
ctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgatttggcgaat
ctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaatcccctgcat
gcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcgccctacctg
ccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccattccggaactc
gtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaacagcacgcc
gaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgcagcactcaag
ctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgccttccgtacc
cgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgagacgtacggc
gatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggtgtcgccgat
ttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtggcagctggac
gagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctgggcatcatg
gcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctgcaggacgtg
ctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactcggccaggac
tggtcgcagccaccgtggcggccggaccggctcgctgagcaggagtaccgaccgtttcgc
gcgctgatccaggccgcgttgcggcacgccggtgcggtacgcatcgaccacatcatcggg
ctgttccggttgtggtggatccccgacggcgcaccgcccacccaaggcacctatgtgcgc
tacgaccacgacgcgatgatcggcatcgtcgccctggaagcccaccgggccggggcggtt
gtcgtcggtgaggatctcggcaccgtcgagccgtgggtacgcgactatctactattgcgg
ggcctgctgggcacctcaattctctggtttgagcaggatcgagattgcgggccggctgga
acaccattgccggccgaacgctggcgggagtactgcttgtcgtcggtgaccacccatgat
ctgccgccgaccgccggctacctggccggcgaccaggtacggctgcgcgagtcccttggg
ttgttaaccaaccccgtggaggcggaactcgaatccgcccgggccgaccgggcagcctgg
atggccgagctgcgccgggtcggactgctggcggacggtgccgagcccgactcggaggag
gccgtcctggctctctaccgctacctgggccgaacgccctcgcggctgttggcagtggcg
ttgaccgatgcggtcggcgaccgccggacgcaaaaccagcctggcaccaccgacgagtac
ccgaactggcgggtgccgctcaccggccccgacggtcagccgatgctgctcgaggacatc
ttcaccgatcgcagggcagccaccttggccgaggcggtgcgcgctgcgacgacctcaccg
atgagctgttggtga

DBGET integrated database retrieval system