KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002275Help
Entry
TBXG_002275       CDS       T02141                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mtz00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2492752..2493453
Genome map
AA seq 233 aa AA seqDB search
MAAGIRNITTTGQIGDGREAAAVDYVLAHAGAGNIDDVLATIDKFAYEKSMLINVGDEKG
TLLDAAVRRADPALALELGTYLGYGALRIARAAPEARVYSVELAEANASNARRIWAHAGV
DDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLDHDKKAYLPDLQSILDRGWLHPGS
IVVADNVRVPGAPTYRAYMRRQQGMSWNTIEHKTHLEYQTLVPDLVLESEYLG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggatccgcaatatcaccacgacgggccagatcggtgatggacgcgaagcg
gcggccgtcgactatgtcctcgcccacgccggggccggcaacatcgacgacgtgctggcc
accatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgacgagaaaggg
acgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggagttgggcacc
tacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagggtgtactcc
gtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcatgccggcgtc
gatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcaccctggacgcg
ctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgaccatgacaag
aaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcacccgggctcg
atcgtggttgccgacaatgtcagggtgcccggcgcgccgacgtaccgtgcatatatgcgc
cggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaataccagacc
ctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system