KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002363Help
Entry
TBXG_002363       CDS       T02141                                 

Definition
tryptophan synthase subunit alpha TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtz01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtz00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mtz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2609424..2610236)
Genome map
AA seq 270 aa AA seqDB search
MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGV
PYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFV
YAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS
ALVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgt
gcaaacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcg
tcggtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggtt
ccgtattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctc
cgtggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggc
gggcgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattc
gcgcgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgac
gaggcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtc
gcgccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtc
tacgcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcaccc
gaactggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtg
cggtcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttcc
gcattggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctc
gctgccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system