KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002364Help
Entry
TBXG_002364       CDS       T02141                                 

Definition
tryptophan synthase subunit beta TrpB
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBXG_002364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBXG_002364
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBXG_002364
Enzymes [BR:mtz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TBXG_002364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2610236..2611504)
Genome map
AA seq 422 aa AA seqDB search
MMTDLSTPDLPRMSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKE
RVSQDFLDDLDRLQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQ
ALLARRMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGA
EVVAVQTGSKTLKDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARV
QIQGQAGRLPDAVVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAG
SPGAFHGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMD
AFGLLCRMEGIIPAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLG
ND
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacagatctatccaccccggatcttccgcgcatgagtgctgccatcgccgaaccg
accagtcacgatcctgattccggcggccatttcggcggccccagtggttggggtggccgc
tacgttcccgaggcgctgatggcggtgatcgaagaggtcaccgccgcctaccaaaaggag
cgcgtcagccaggactttctggacgacctagacaggctgcaggcgaactatgcgggccgg
ccttcgccgctttacgaggcgacccggttgagccagcacgctgggtcggcgcgaatcttt
ctgaagcgagaagacctgaaccatactggttctcacaagatcaacaacgtgctcgggcag
gcactgctggcgcgcaggatgggcaagacccgggtgatcgccgagaccggtgccggccag
cacggggtcgccacggccaccgcatgcgcattgctcggcctggactgtgtcatctacatg
gggggcatcgacaccgcccgtcaggcgctaaacgtggcccggatgcgattgctgggtgcc
gaagtcgtcgcggttcagacgggctcgaaaacgctcaaagacgccatcaatgaggcgttc
cgggattgggttgccaacgccgacaacacctactactgctttggtactgcggccggaccg
catccgtttccaaccatggtgcgcgatttccagcgaatcatcggcatggaggcacgtgtg
cagatccagggtcaggccggtcggctgcctgacgccgtcgtcgcgtgcgttggtggcggg
tccaatgccattggtatttttcatgcgtttctcgatgacccaggcgtacggctggtcgga
ttcgaggcagccggcgacggcgttgagaccggccggcatgccgcgacattcaccgctggt
tcgcccggggcatttcacggatcgttctcgtacttgctgcaagacgaggacggtcagacc
attgaatcccattcaatttccgcgggtctggattatccgggggtgggcccggaacatgcg
tggctcaaggaggccgggcgtgtcgattatcggccgatcaccgactccgaggcgatggac
gcgtttggcctgctgtgtcgcatggaaggcatcatcccggctattgaatccgcgcacgcg
gtggccggcgccctcaagctaggtgttgagttgggaaggggcgcggtgattgtggtgaac
ctgtcgggacgtggcgacaaagatgtcgagacggccgcgaaatggtttggcttgctgggc
aacgactga

DBGET integrated database retrieval system