KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002365Help
Entry
TBXG_002365       CDS       T02141                                 

Definition
indole-3-glycerol phosphate synthase trpC
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtz01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mtz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2611537..2612385)
Genome map
AA seq 282 aa AA seqDB search
MGDSGKGTAGMSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREP
GIGVIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRA
SVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVH
TEQEADRALKAGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLA
YAGAGADAVLVGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacagtgggaagggaacggcaggcatgagtccggcaaccgtgctcgactccatc
ctcgagggagtccgggccgacgttgccgcgcgtgaagcctcggtgagcctgtcggagatc
aaggctgccgccgctgcggcgccgccgccgctcgacgtgatggccgccctacgcgagccc
ggcatcggcgtcatcgctgaggtcaagcgcgctagtccttcggcaggcgcattggcgacc
atcgccgacccggcaaagctggcccaggcctaccaggatggcggtgcccggatcgtcagc
gtggtgactgagcagcggcgttttcagggatcgctcgacgacctcgacgcggtgcgggcc
tcggtttcgattccggtgctgcgcaaggactttgtggtgcagccgtaccagattcatgag
gcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcattggagcagtcggtg
ttggtgtcgatgttggaccgcaccgaatcgttgggtatgacagcactcgtcgaggtccat
accgagcaggaagccgaccgagcgctgaaggccggggccaaggtgattggcgttaacgcc
cgcgacctcatgacgctggacgtggaccgggattgcttcgcgcgaatagctcctggtttg
ccgagcagtgtgatcaggattgctgaatccggcgtgcgtggcaccgctgacctgctggcg
tacgccggcgcgggcgctgacgcggtgttggtaggcgaaggtctggtcaccagcggcgac
ccacgtgccgcggttgccgatctggttaccgcgggcacccatccgtcctgtccgaaaccg
gctcgctag

DBGET integrated database retrieval system