KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002365Help
Entry
TBXG_002365       CDS       T02141                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase trpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01130  Biosynthesis of antibiotics
mtz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBXG_002365
Enzymes [BR:mtz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TBXG_002365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFM49773
Structure
PDB: 

Jmol
Position
complement(2611537..2612385)
Genome map
AA seq 282 aa AA seqDB search
MGDSGKGTAGMSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREP
GIGVIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRA
SVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVH
TEQEADRALKAGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLA
YAGAGADAVLVGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacagtgggaagggaacggcaggcatgagtccggcaaccgtgctcgactccatc
ctcgagggagtccgggccgacgttgccgcgcgtgaagcctcggtgagcctgtcggagatc
aaggctgccgccgctgcggcgccgccgccgctcgacgtgatggccgccctacgcgagccc
ggcatcggcgtcatcgctgaggtcaagcgcgctagtccttcggcaggcgcattggcgacc
atcgccgacccggcaaagctggcccaggcctaccaggatggcggtgcccggatcgtcagc
gtggtgactgagcagcggcgttttcagggatcgctcgacgacctcgacgcggtgcgggcc
tcggtttcgattccggtgctgcgcaaggactttgtggtgcagccgtaccagattcatgag
gcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcattggagcagtcggtg
ttggtgtcgatgttggaccgcaccgaatcgttgggtatgacagcactcgtcgaggtccat
accgagcaggaagccgaccgagcgctgaaggccggggccaaggtgattggcgttaacgcc
cgcgacctcatgacgctggacgtggaccgggattgcttcgcgcgaatagctcctggtttg
ccgagcagtgtgatcaggattgctgaatccggcgtgcgtggcaccgctgacctgctggcg
tacgccggcgcgggcgctgacgcggtgttggtaggcgaaggtctggtcaccagcggcgac
ccacgtgccgcggttgccgatctggttaccgcgggcacccatccgtcctgtccgaaaccg
gctcgctag

DBGET integrated database retrieval system