KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002377Help
Entry
TBXG_002377       CDS       T02141                                 

Definition
histidinol dehydrogenase hisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBXG_002377
  Amino acid metabolism
   00340 Histidine metabolism
    TBXG_002377
Enzymes [BR:mtz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TBXG_002377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2621696..2623030)
Genome map
AA seq 444 aa AA seqDB search
MTAPPPVLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFG
ASFDGVRPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGA
TVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTI
LAAARLLGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSR
VGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAG
QLQTTVHRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSA
GAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSG
HVITLATAEDLPAHGEAVRRRFER
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgccgcccgtgcttacccgtatcgacttgcggggagccgagttgacagct
gccgagctgcgggccgctctgccacgcggcggcgccgatgtggaagccgtgctgccgacg
gtacggcccattgtggcggccgtcgccgagcgcggggccgaggccgcgctggacttcggc
gcatcgttcgacggtgtgcggccccatgccatccgggtgccagacgcagcgctggacgcg
gcgctggccggactggactgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacc
cgcgccgtgcactccgggcagcgtcgcaccgacgtcacaaccacactgggcccgggcgcg
acggtcaccgagcggtgggttccggtcgagcgggtaggcctgtacgtgccggggggcaat
gcggtgtacccatccagcgtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgac
tcgttggtggtagccagcccgccgcaggcgcagtgggatggaatgccgcatccgaccatt
ctggccgcggcccggctgctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcg
gtggcgttgctggcttacggcggcaccgacaccgacggcgcagcactgacaccggtcgac
atgatcaccgggcctggcaacatctatgtcacggccgccaagcgactgtgccgttcgcgg
gtgggcatcgacgccgaagcggggccaaccgagatcgctatcctcgccgatcacaccgcc
gacccggtgcatgtggccgccgacctgattagccaggccgaacacgacgagttggctgcc
agcgtgctggtcactccgagtgaggacctggccgatgccaccgacgccgaactggctggc
cagctgcagactacggtgcaccgcgaacgggtgacggccgcgctgaccggacgccaatcg
gcgatcgtcctggtcgacgacgtggacgccgccgtcttggtggtgaacgcttacgccgct
gagcatttggagattcagaccgccgatgccccgcaggttgccagccggatccgctcggcg
ggagccattttcgtcggcccgtggtccccggtgagcctcggcgactactgcgcgggatcc
aaccatgtactgccgaccgcgggctgcgcccggcattccagcggcctgtcggtgcagacg
ttcctgcgcggcatccacgtcgtggaatacacggaggcggccctcaaagacgtttccgga
cacgtgatcacgctcgccacggccgaggacttgccggcgcacggtgaggcggtacggcgg
aggttcgagcgatga

DBGET integrated database retrieval system