KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002580Help
Entry
TBXG_002580       CDS       T02141                                 

Definition
aspartate carbamoyltransferase pyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mtz00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mtz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2859283..2860242)
Genome map
AA seq 319 aa AA seqDB search
MTPRHLLTAADLSRDDATAILDDADRFAQALVGRDIKKLPTLRGRTVVTMFYENSTRTRV
SFEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAQW
TGAHNDGPAVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRIVIVGDILHSRVARSNVM
LLDTLGAEVVLVAPPTLLPVGVTGWPATVSHDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSVRYGLTERRQAMLPGHAVVLHPGPMVRGMEITSSVADSSQSAVLQQVSNGVQVRM
AVLFHVLVGAQDAGKEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaggcacctgctgaccgccgccgacctcagccgcgacgacgccaccgccatc
ctcgacgacgccgaccggtttgcgcaggcgctggtcggtcgcgacatcaagaagctgccg
acgctgcggggccggaccgtcgtcacgatgttctatgagaactccacccgcacccgggtg
tcgttcgaggtagcgggtaagtggatgagcgccgacgtgatcaacgtcagcgctgccgga
tcttcggtaggcaagggtgagtcgctgcgggataccgcgctgaccctgcgcgcggccggg
gctgacgcgctgatcatccgccatcccgcgtccggcgccgcccatctgctggcgcagtgg
accggcgcccacaacgatgggccggcggtgatcaacgccggtgacggcactcatgaacac
cccacgcaggcgctgcttgatgcgctgaccatccgtcagcgcctcggcggcatcgaaggc
cggcgcatcgtgatcgtcggcgacatcctgcacagccgggtcgcccgctccaacgtcatg
ctgctggacaccctgggcgccgaggtggtgctggtggcgccacccacattgctaccggtc
ggggtgaccggctggccggccaccgtctcccacgacttcgatgccgagctgcccgccgcc
gacgcggtattgatgctgcgggtacaggccgagcggatgaacggcggttttttcccgtcc
gtacgggagtactcggtccgctacgggctaaccgagcggcgccaggcgatgcttcccggc
cacgccgtggtgttgcacccgggaccgatggtgcgtggcatggagatcacatcttcggtc
gcggactcgtcgcaatcggctgtgctgcaacaggtttccaatggagtccaggtgcggatg
gcggtgctgttccatgtgctggtgggagcgcaggatgccggtaaagagggtgcggcgtga

DBGET integrated database retrieval system