KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002897Help
Entry
TBXG_002897       CDS       T02141                                 

Definition
(GenBank) enoyl-CoA hydratase echA8
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00071  Fatty acid degradation
mtz00280  Valine, leucine and isoleucine degradation
mtz00281  Geraniol degradation
mtz00310  Lysine degradation
mtz00360  Phenylalanine metabolism
mtz00362  Benzoate degradation
mtz00380  Tryptophan metabolism
mtz00410  beta-Alanine metabolism
mtz00627  Aminobenzoate degradation
mtz00640  Propanoate metabolism
mtz00650  Butanoate metabolism
mtz00903  Limonene and pinene degradation
mtz00930  Caprolactam degradation
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01120  Microbial metabolism in diverse environments
mtz01130  Biosynthesis of antibiotics
mtz01212  Fatty acid metabolism
Module
mtz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBXG_002897
   00650 Butanoate metabolism
    TBXG_002897
  Lipid metabolism
   00071 Fatty acid degradation
    TBXG_002897
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBXG_002897
   00310 Lysine degradation
    TBXG_002897
   00360 Phenylalanine metabolism
    TBXG_002897
   00380 Tryptophan metabolism
    TBXG_002897
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBXG_002897
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBXG_002897
   00281 Geraniol degradation
    TBXG_002897
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBXG_002897
   00627 Aminobenzoate degradation
    TBXG_002897
   00930 Caprolactam degradation
    TBXG_002897
Enzymes [BR:mtz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBXG_002897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF218
Motif
Other DBs
NCBI-ProteinID: AFM50305
Structure
PDB: 

Jmol
Position
3216681..3217454
Genome map
AA seq 257 aa AA seqDB search
MTYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKA
FAAGADIKEMADLTFADAFTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVV
PADDLLTEARATATTISQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATEDQS
EGMAAFIEKRAPQFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacgaaaccatcctggtcgagcgcgatcagcgagttggcattatcacgctgaac
cgtccccaggcactgaacgcgctcaacagccaggtgatgaacgaggtcaccagcgctgca
accgaactggacgatgacccggacattggggcgatcatcatcaccggttcggccaaagcg
tttgccgccggagccgacatcaaagaaatggccgacctgacgttcgccgacgcgttcacc
gccgacttcttcgccacctggggcaagctggccgccgtgcgcaccccgacgatcgccgcg
gtggcgggatacgcgctcggcggtggctgcgagctggcgatgatgtgcgacgtgctgatc
gccgccgacaccgcgaagttcggacagcccgagataaagctgggcgtgctgccaggcatg
ggcggctcccagcggctgacccgggctatcggcaaggctaaggcgatggacctcatcctg
accgggcgcaccatggacgccgccgaggccgagcgcagcggtctggtttcacgggtggtg
ccggccgacgacttgctgaccgaagccagggccactgccacgaccatttcgcagatgtcg
gcctcggcggcccggatggccaaggaggccgtcaaccgggctttcgaatccagtttgtcc
gaggggctgctctacgaacgccggcttttccattcggctttcgcgaccgaagaccaatcc
gaaggtatggcagcgttcatcgagaaacgcgctccccagttcacccaccgatga

DBGET integrated database retrieval system