KEGG   Mycobacterium tuberculosis KZN 605: TBXG_003550Help
Entry
TBXG_003550       CDS       T02141                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00360  Phenylalanine metabolism
mtz00362  Benzoate degradation
mtz00620  Pyruvate metabolism
mtz00621  Dioxin degradation
mtz00622  Xylene degradation
mtz00650  Butanoate metabolism
mtz01100  Metabolic pathways
mtz01120  Microbial metabolism in diverse environments
mtz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBXG_003550
   00650 Butanoate metabolism
    TBXG_003550
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TBXG_003550
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBXG_003550
   00622 Xylene degradation
    TBXG_003550
   00621 Dioxin degradation
    TBXG_003550
Enzymes [BR:mtz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TBXG_003550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFM50981
Structure
PDB: 

Jmol
Position
complement(3959821..3960732)
Genome map
AA seq 303 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGRAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctggacgcgccg
aacgtcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtct
cggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcggga
ccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccagacc
atcggcagggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatg
atcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgcc
gcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctc
aacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacg
ttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggacatc
atgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgtagga
ggagcgcgatga

DBGET integrated database retrieval system