KEGG   Mycobacterium tuberculosis KZN 605: TBXG_003730Help
Entry
TBXG_003730       CDS       T02141                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TBXG_003730
DNA repair and recombination proteins [BR:mtz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TBXG_003730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4147704..4148315)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCG
NVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRVLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacccgtccaggacctgattgacgaactcggcaagttgccggggatcgga
cccaagagtgcgcagcgaatcgccttccacctgttgtcggtagaaccgtcggacatcgac
cggctgaccggtgtgctggcgaaggttcgggacggcgtgcgattctgcgcggtgtgtggg
aatgtctctgacaacgagcgttgcagaatctgctctgatatccgtcgcgatgcgtccgtg
gtgtgcattgtcgaggaacccaaagacatccaggccgtcgagcgcacccgcgagttccgg
ggtcgctatcacgtcctgggcggggcgcttgacccgctgtccggaattgggccggatcag
ctgcggatccgcgaactgctgagccgcatcggggaacgggtcgacgacgtcgacgtcacc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggcgacggccacctacctggtg
cgaatgctgcgcgacatccccggcctgaccgtcacacggatcgcgtccgggctgccgatg
ggcggtgacctggaattcgccgacgagctcaccctgggccgagcgctcgccggccgccgc
gtgctcgcctga

DBGET integrated database retrieval system