KEGG   Mycobacterium tuberculosis KZN 605: TBXG_004002Help
Entry
TBXG_004002       CDS       T02141                                 

Definition
(RefSeq) isocitrate lyase aceAb
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBXG_004002
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TBXG_004002
Enzymes [BR:mtz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TBXG_004002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2259979..2261175)
Genome map
AA seq 398 aa AA seqDB search
MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKT
PEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNL
SPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLAL
ARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPR
KLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGR
TILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFT
EVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacctacggagaggccgtggcggacgtgctcgaattcggtcagagcgagggcgaaccc
attggcatggctcccgaggagtggcgggcgttcgccgcgcgtgcatcgctgcatgccgcc
cgggcaaaggccaaggagctgggcgccgatccgccatgggactgcgagctggccaagacc
ccggagggctactaccagatccgcggcggcataccgtatgcgatcgccaaatcgctggcc
gcggcaccgtttgccgacattctttggatggagaccaagaccgccgatctcgccgacgct
cgacagttcgccgaggcgatccatgccgagttccccgaccagatgctggcgtacaacctc
tcaccatcgttcaactgggacaccaccggcatgaccgacgaggagatgcggcgcttcccc
gaggagctcggcaaaatgggcttcgtcttcaacttcatcacctatggcgggcaccagatc
gacggtgtcgcggccgaggaattcgccaccgcgctgcgccaggacggcatgctggcgctg
gctcggttgcagcgcaagatgcgcttggtcgaatctccctatcgcacaccgcaaacgcta
gtcggcgggccgcgcagtgacgccgcattggctgcctcctccggacgcacggcgaccacg
aaggcaatgggcaagggctccacccagcaccagcacttggtgcaaactgaggtgccgcgc
aagctgctagaggaatggctggccatgtggagcggtcactaccagctcaaagacaaactg
cgcgtacagcttcggccgcagcgggccggctcggaggtgctcgagctcggcatccacggc
gaaagcgatgacaagctcgccaacgtgatattccaaccgatccaagatcgccgcggccgc
accatcctgttggtacgcgaccagaacacgttcggtgcggaactacgccaaaagcggctg
atgaccctgatccacctctggctcgtccaccgcttcaaggcgcaggcggtgcactacgtc
acgcccaccgacgacaacctctaccagacctcgaagatgaagtcgcatggaatcttcacc
gaggtcaaccaggaggtgggcgagatcatcgtcgccgaggtgaaccacccgcgcatcgcc
gaactgctgacgcccgatcgggtggcgctgcggaagttgatcacgaaggaggcgtag

DBGET integrated database retrieval system