KEGG   Mycobacterium tuberculosis KZN 605: TBXG_004003Help
Entry
TBXG_004003       CDS       T02141                                 

Definition
isocitrate lyase aceAa
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mtz01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mtz00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261175..2262278)
Genome map
AA seq 367 aa AA seqDB search
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVA
REAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDP
GPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADAGT
GHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFTNWAS
RSSMVIFSMRLATASTRRPAVGLSAKAFSAWSPTRSTRGGRTASSRSTAFSTRSSRGSWR
PGRTTRA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgaaacggacaccgaggtccacacaccgttcgagcaggactttgagaaa
gacgtagccgccactcagcgatacttcgacagctcgcgctttgctgggatcattcggctc
tacaccgcccgccaagtcgtggaacagcgcggcacgatccccgtcgaccacatcgtggcg
cgagaggcggcgggcgccttctacgagcgtctgcgcgaactctttgcagcccgcaagagc
atcacgacgtttggcccctactcgccggggcaggcggtgagcatgaagcggatgggtatc
gaggcgatctacctcggtggttgggctacctcagctaagggctccagcaccgaagatccg
gggcccgacctcgccagctacccgctgagccaggtgcctgacgatgccgcggtgctggtg
cgcgccttgctcaccgcggaccgcaaccaacactatctacgcctgcagatgagcgagcga
cagcgtgcggcgacaccggcttacgacttccgcccgtttatcatcgccgacgccggcacc
ggccacggcggcgatccgcacgtacgcaacctgatccgccgcttcgtcgaggtcggtgtg
ccgggctaccacatcgaggaccaacgacccggcaccaagaagtgcggccaccagggcggc
aaggtcctggtgccgtccgacgaacagatcaagcggctcaacgccgcccgcttccagctc
gacatcatgcgggtgcccggcatcatcgtcgcacgcaccgacgcggaggcggccaacctg
atcgacagtcgcgccgacgagcgtgaccagccgttccttctcggcgcgaccaagctcgac
gtaccgtcctacaagtcctgtttcctggcaatggtgcggcgttttacgaactgggcgtca
aggagctcaatggtcatcttctctatgcgcttggcgacagcgagtacgcggcggccggcg
gttggcttgagcgccaaggcattttcggcttggtctccgacgcggtcaacgcgtggcggg
aggacggccagcagtcgatcgacggcattttcgaccaggtcgagtcgcggttcgtggcgg
cctgggaggacgacgcgggcctga

DBGET integrated database retrieval system