KEGG   Mycobacterium ulcerans: MUL_0295Help
Entry
MUL_0295          CDS       T00435                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation protein FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00071  Fatty acid degradation
mul00280  Valine, leucine and isoleucine degradation
mul00281  Geraniol degradation
mul00310  Lysine degradation
mul00362  Benzoate degradation
mul00380  Tryptophan metabolism
mul00410  beta-Alanine metabolism
mul00640  Propanoate metabolism
mul00650  Butanoate metabolism
mul00903  Limonene and pinene degradation
mul00930  Caprolactam degradation
mul01040  Biosynthesis of unsaturated fatty acids
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01200  Carbon metabolism
mul01212  Fatty acid metabolism
Module
mul_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MUL_0295 (fadB)
   00650 Butanoate metabolism
    MUL_0295 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_0295 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    MUL_0295 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUL_0295 (fadB)
   00310 Lysine degradation
    MUL_0295 (fadB)
   00380 Tryptophan metabolism
    MUL_0295 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MUL_0295 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MUL_0295 (fadB)
   00281 Geraniol degradation
    MUL_0295 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_0295 (fadB)
   00930 Caprolactam degradation
    MUL_0295 (fadB)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MUL_0295 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MUL_0295 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MUL_0295 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8 UDPG_MGDP_dh_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABL03030
Pasteur: MUL_0295
UniProt: A0PL11
Position
complement(301919..304063)
Genome map
AA seq 714 aa AA seqDB search
MADNTIQWDKDADGIVTLTMDDPSGSANVMNEAYIESMGKAVDRLVAEKDSITGVVITSA
KKTFFAGGDLTSMIQAGPEDAGQSFDTVETVKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADAKGSQLGLPEATLGLLPGGGGVTRTVRMFGIQNAFVSILSQGTRFKPAK
AKEIGLVDEVLPTVEELVPAAKAWIKANPDSHEQPWDKKGYKIPGGTPSSPGLASILPSF
PALLRKQLKGAPMPAPKAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMIQAFFF
DLQAINAGKSRPDGIGKTPITKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSAEAAAKGK
GYSEKLVAKALERGRTTQEKGDALLARITPTSDAADLKGVDFVIEAVFENQELKHKVFQE
IEDIVEPNAVLGSNTSTLPITGLATGVKRQEDFIGVHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDGRGFFASRVIGTFVNEALAMLGEGVEPSSIEQAGSQAGYP
APPLQLSDELNLELMHKIATATRKGVEDAGGTYEPHPAEAVVEKMIEVGRSGRLKGAGFY
EYPEGKRAGLWPGLRETFKSGTSEPPLQDMIDRMLFAEALETQKCLDENVLMSTADANIG
SIMGIGFPPWTGGSAQYIVGYEGALGRGKEAFVTRARELAAKYGDRFLPPDSLT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaacacaattcagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgacccgtcggggtcggccaacgtcatgaacgaggcctacatcgagtcgatgggcaag
gcggtggatcgccttgttgccgaaaaggattcgattaccggagtggtgatcaccagcgcc
aagaagaccttcttcgccggtggtgacctcacatccatgatccaggccggtccggaagac
gccgggcagtccttcgacacggtcgagacggtcaagcggcagctgcgaaccctggagacg
ctgggcaagcccgtcgtcgccgcgatcaacggcgcggcactcggcggtggcctcgagatt
gcgctggcctgccatcaccgcatcgcggccgacgccaagggcagccagctgggtctgccc
gaggcgaccctgggcctgctgcccggtggcggcggggtgacccgcaccgtgcgcatgttc
ggtatccagaacgccttcgtgagcatcctgtcccagggcacccggttcaagccggccaag
gccaaggagatcgggctggtcgacgaggtgctgccgacggtcgaggagctggtgcccgcc
gccaaggcgtggatcaaggccaacccggattcccacgagcagccctgggacaagaagggt
tacaagatcccgggcggcactccgtcgtcgccggggttggcttccatcctgccgtcgttc
ccggccttgttgcgcaaacagctcaagggcgctccgatgccggccccgaaggccattctg
gccgccgcggtcgagggtgcgcaggtcgatttcgacaccgccagccgcatcgagagccgc
tacttcgcctcgctggtcaccggccaggtcgccaagaacatgattcaggcgttcttcttc
gacctgcaggccatcaacgccggcaagtcgcggccggacggcatcggcaagaccccgatc
accaagatcggtgtgctcggtgccggcatgatgggcgcgggcatcgcctacgtctcggcc
aaggccggctacgacgtggtgctcaaggacgtcagcgcggaggccgccgccaagggcaag
ggctactccgagaagctggtggccaaggcactcgagcgcggtcgcaccacccaggagaag
ggcgacgcgctgctggctcgcatcaccccgacctcggacgcggccgacctcaagggcgtg
gacttcgtcatcgaggccgtgttcgaaaaccaggaactcaagcacaaggtgttccaggag
atcgaggacatcgtcgagcccaacgcggtgctgggatcgaacacctccacgttgccgatc
accggtctggccaccggggtcaagcgccaagaggacttcatcggtgtccacttcttctcc
ccggtcgacaagatgccgctggtcgagatcatcaagggtgagaagacctccgacgaggcc
ctggcccgggtgttcgactacaccctggcaatcggcaagaccccgatcgtggtgaacgac
ggccgcggcttcttcgcctcccgggtcatcggcaccttcgtcaacgaggcgctggcgatg
ctcggtgagggtgtcgagccgtcgtcgatcgagcaggcgggatcgcaggccggctacccg
gccccgccgctgcagctgtccgacgagctcaacctggagctgatgcacaagatcgctacc
gctacccgcaagggtgtcgaggacgccggtggcacctacgagccgcacccggccgaagcg
gttgtcgagaagatgatcgaggttggtcggtccggtcggctcaagggcgcgggcttctac
gagtaccccgagggcaagcgtgccggcctgtggccgggcctgcgggagacgttcaagtcg
ggcacctcggagccgccgctgcaggacatgatcgaccggatgttgttcgccgaggcgctg
gaaacccagaagtgcctcgacgagaacgtgctgatgtcgacggccgacgccaacatcgga
tccatcatgggtatcggcttcccgccgtggaccggtggtagcgcgcagtacatcgtcggc
tacgagggtgcgctcggccggggcaaagaggccttcgtgacccgcgcccgcgagctggcc
gccaagtacggcgaccgcttcctgccgccggactcgctgacctaa

DBGET integrated database retrieval system