KEGG   Mycobacterium ulcerans: MUL_0495Help
Entry
MUL_0495          CDS       T00435                                 

Gene name
adhX
Definition
Zn-dependent alcohol dehydrogenase, AdhX
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MUL_0495 (adhX)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_0495 (adhX)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_0495 (adhX)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUL_0495 (adhX)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MUL_0495 (adhX)
   00626 Naphthalene degradation
    MUL_0495 (adhX)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MUL_0495 (adhX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
512418..513479
Genome map
AA seq 353 aa AA seqDB search
MTQTLANPGATQATETLRAAVVTGFGEPLQIKELALPTPGYGEALVKLETSGVCHTDLHA
AHGDWPVKPAPPFVPGHEGCGTVVALGDGVTDLKVGDKVGNAWLWSACGSCEQCRTGWET
LCENQRNGGYTVNGSFGTYMLVNADYAARIPDGADPLEVAPILCAGVTVYKGLKVTDTRP
GQWVAISGIGGLGHVAVQYARAMGLRVVAIDIDDDKLALAARLGAELVVNARTSDVVAQV
QEATGGVHGVLVTAVHPQAFGQAIGLARRGGTIVFNGLPPGDFPAPIFVIVLKGLTIRGS
IVGTRQDMAEALDFYARGLIHPTVEGAALEDINHVFERMERGQIDGRVVIDYR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacactggctaacccaggtgcaacgcaggcgaccgaaacgctgcgcgcggcg
gtcgtcaccggattcggcgagccgttacagatcaaggaactcgcgttgcccaccccgggc
tacggtgaggcacttgtcaaactcgagacctcgggtgtgtgccacaccgatctgcatgcg
gcacatggagattggccggtcaagccggccccgccgttcgttcccgggcatgaaggctgc
ggcaccgtggtcgcgctcggggacggcgtcaccgacctgaaggtcggcgacaaggtgggc
aatgcctggctgtggtcggcgtgcggcagctgcgaacagtgccgtaccggatgggaaacg
ctgtgcgaaaaccagcgcaacggcggctacaccgtcaacggcagcttcggcacctacatg
ctggtcaacgccgactacgcggcacgcatccccgacggtgccgacccgctcgaggtcgcg
ccgatcctgtgcgccggtgtcaccgtctataaggggctcaaggtgaccgacacccggccg
ggccagtgggtcgccatttcaggaatcggcgggctcggccatgttgccgtgcagtacgcc
cgcgcgatgggcttgcgggtggtggccatcgacatcgatgacgacaagctcgcgctggcc
gcccggctgggcgccgaactggtggtcaatgcccgtaccagcgatgtcgtcgcgcaggtg
caagaagccaccggcggggtgcacggcgtcctggtcaccgccgtgcatccgcaggcgttt
gggcaggccatcgggctggcgcggcgcggcggaacgatcgtgttcaacgggctacccccg
ggggacttcccggcgccgatcttcgtcatcgtgctcaagggcctgacgattcgcggttcg
attgtcggcacccgccaggacatggccgaggcgctggacttctacgcccgcggtttgatt
caccccacggtggaaggcgccgcgctcgaagacatcaaccacgtcttcgagcgcatggag
cgcggccagatcgacggccgcgtcgtcatcgactaccggtag

DBGET integrated database retrieval system