KEGG   Mycobacterium ulcerans: MUL_0739Help
Entry
MUL_0739          CDS       T00435                                 

Definition
carbohydrate kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_0739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_0739
   00052 Galactose metabolism
    MUL_0739
   00500 Starch and sucrose metabolism
    MUL_0739
   00520 Amino sugar and nucleotide sugar metabolism
    MUL_0739
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MUL_0739
   00524 Butirosin and neomycin biosynthesis
    MUL_0739
Enzymes [BR:mul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MUL_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
775046..775954
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKVAVGLADADGALVHTAQVPTPARCAAEQVWAAVAEAIAEALRVADATV
AAVGIASAGPVDLDSGTVSPINIGSWRGFPLRDRVAAMVPDVPVRLGGDGVCMALGEHWL
GAGRGARFLLGMVVSTGVGGGLVLGGVPYPGRTGNAGHVGHVVVDQDGLRCSCGGRGCVE
TIAAGPSMVRWARANGWSARPEAGARELAAAAAAGDAVALAAFRRGTRGLAAMIASVGAV
CDLDRVVIGGGVAKAGRLLFDPLRAALADYLGLDFLAGLRVVPAELGGQAGLVGAARLAG
LG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccctctgtctggacatcggcggcaccaaggtcgccgtcgggctggccgacgcc
gacggcgcgctggtgcacaccgcccaggtgccgaccccggcgcgatgcgcggccgagcag
gtctgggccgcagtcgccgaggcgatcgccgaggcattgcgggtggccgacgccacggtg
gctgcggtgggcatcgcctcggccgggccggtcgacctggatagcgggacggtcagcccg
atcaatatcggctcctggcgcggcttcccgctgcgagaccgggttgcggccatggtgccc
gatgtgccggtgcggctgggcggcgatggggtctgcatggcgctcggcgagcactggctg
ggtgcgggacggggagcacgtttcctgttgggcatggtggtgtccaccggtgtcggcggg
gggctggtgctcggcggcgtcccgtatccgggccgcaccggcaacgcgggacacgtgggg
catgtcgtggtcgatcaggatggcctgcggtgttcctgcggtggccgtggctgtgtcgag
acgatcgccgctggcccatcgatggttcgatgggctcgggccaacggttggtcggcgcgg
cccgaagcgggcgccagggaattggcggccgcggcagccgccggagatgccgtggcgctg
gcggcctttcgccggggcacccgtggcctggccgccatgatcgcctcggtgggcgcggtg
tgcgacctcgaccgggttgtcatcgggggaggggtcgccaaagccgggcgcctgttattc
gacccgctgcgcgcggcattggccgactacctcgggctggactttttggccggcctgcgc
gttgtgcccgccgagctaggcggacaggccggtctggtcggtgccgcccgccttgccggg
ctcggctag

DBGET integrated database retrieval system