KEGG   Mycobacterium ulcerans: MUL_0754Help
Entry
MUL_0754          CDS       T00435                                 

Gene name
echA4
Definition
(GenBank) enoyl-CoA hydratase, EchA4
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00071  Fatty acid degradation
mul00280  Valine, leucine and isoleucine degradation
mul00281  Geraniol degradation
mul00310  Lysine degradation
mul00360  Phenylalanine metabolism
mul00362  Benzoate degradation
mul00380  Tryptophan metabolism
mul00410  beta-Alanine metabolism
mul00627  Aminobenzoate degradation
mul00640  Propanoate metabolism
mul00650  Butanoate metabolism
mul00903  Limonene and pinene degradation
mul00930  Caprolactam degradation
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01212  Fatty acid metabolism
Module
mul_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MUL_0754 (echA4)
   00650 Butanoate metabolism
    MUL_0754 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_0754 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUL_0754 (echA4)
   00310 Lysine degradation
    MUL_0754 (echA4)
   00360 Phenylalanine metabolism
    MUL_0754 (echA4)
   00380 Tryptophan metabolism
    MUL_0754 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MUL_0754 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MUL_0754 (echA4)
   00281 Geraniol degradation
    MUL_0754 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_0754 (echA4)
   00627 Aminobenzoate degradation
    MUL_0754 (echA4)
   00930 Caprolactam degradation
    MUL_0754 (echA4)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MUL_0754 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABL03399
Pasteur: MUL_0754
UniProt: A0PM30
Position
798789..799727
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALVERADLDPAVQ
VILVSGRGEGFCAGFDLSAYAEGSSSSGAEGGYRGTVLDGKAQAVNHLPNQPWDPMIDYQ
MMSRFVRGFSSLTHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPDPKDLDERTERLVERIAALPV
NQLIMIKLALNSALLQQGGVNSRMLSTVFDGVARHTPEGHAFVADAVEHGFRDAVNHRDE
PFGDYGRRASSV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgccatcaggccggtcgacttcgacaacctgaaaacgatgacctacgaggtc
accgaccgggttgcccggatcaccttcaatcggcccgagaagggcaatgcgatcgtcgcg
gacaccccattggagctctcggcgctggtggagcgcgccgatcttgacccggcggtgcaa
gtcattctggtgtccggccggggcgagggattctgcgcgggatttgacctgtcggcctat
gccgaggggtcgtcctcatccggcgccgagggcggctatcgcggaacggtgctcgacggc
aaggcccaggccgtcaaccacttacccaatcagccctgggacccgatgatcgactatcag
atgatgagccggtttgtgcgcgggttctccagcctgacgcatgccgacaagccgaccgtg
gtaaagatccacggttactgcgttgcgggcggcaccgacatcgcgttgcacgccgatcag
gtgatcgccgccgccgacgcgaaaatcggctacccgccgacgcgggtatggggtgttccg
gcggcgggcctatgggcacaccggctcggtgaccaacgcgccaaacggctgttgttcacc
ggcgattgcatcaccggtgcgcaggccgccgagtggggcctcgcggtcgaggcccccgac
cccaaggacctggatgagcgcacggagcgcctggtcgagcggatcgccgcgctgccggtc
aatcagctgatcatgatcaagctggcgctcaactcggcactgctgcagcaagggggggtc
aacagccggatgctcagcacggtgttcgacggcgtagctcggcacacccccgaggggcac
gcctttgtcgccgacgcggtcgagcatggcttccgggatgcggtgaaccatcgagacgag
ccgttcggagactacggccgccgggcgtcttcggtttga

DBGET integrated database retrieval system