KEGG   Mycobacterium ulcerans: MUL_0754Help
Entry
MUL_0754          CDS       T00435                                 

Gene name
echA4
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mul  Mycobacterium ulcerans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MUL_0754 (echA4)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MUL_0754 (echA4)
   00650 Butanoate metabolism
    MUL_0754 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_0754 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUL_0754 (echA4)
   00310 Lysine degradation
    MUL_0754 (echA4)
   00360 Phenylalanine metabolism
    MUL_0754 (echA4)
   00380 Tryptophan metabolism
    MUL_0754 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MUL_0754 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MUL_0754 (echA4)
   00281 Geraniol degradation
    MUL_0754 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_0754 (echA4)
   00627 Aminobenzoate degradation
    MUL_0754 (echA4)
   00930 Caprolactam degradation
    MUL_0754 (echA4)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MUL_0754 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
798789..799727
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALVERADLDPAVQ
VILVSGRGEGFCAGFDLSAYAEGSSSSGAEGGYRGTVLDGKAQAVNHLPNQPWDPMIDYQ
MMSRFVRGFSSLTHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPDPKDLDERTERLVERIAALPV
NQLIMIKLALNSALLQQGGVNSRMLSTVFDGVARHTPEGHAFVADAVEHGFRDAVNHRDE
PFGDYGRRASSV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgccatcaggccggtcgacttcgacaacctgaaaacgatgacctacgaggtc
accgaccgggttgcccggatcaccttcaatcggcccgagaagggcaatgcgatcgtcgcg
gacaccccattggagctctcggcgctggtggagcgcgccgatcttgacccggcggtgcaa
gtcattctggtgtccggccggggcgagggattctgcgcgggatttgacctgtcggcctat
gccgaggggtcgtcctcatccggcgccgagggcggctatcgcggaacggtgctcgacggc
aaggcccaggccgtcaaccacttacccaatcagccctgggacccgatgatcgactatcag
atgatgagccggtttgtgcgcgggttctccagcctgacgcatgccgacaagccgaccgtg
gtaaagatccacggttactgcgttgcgggcggcaccgacatcgcgttgcacgccgatcag
gtgatcgccgccgccgacgcgaaaatcggctacccgccgacgcgggtatggggtgttccg
gcggcgggcctatgggcacaccggctcggtgaccaacgcgccaaacggctgttgttcacc
ggcgattgcatcaccggtgcgcaggccgccgagtggggcctcgcggtcgaggcccccgac
cccaaggacctggatgagcgcacggagcgcctggtcgagcggatcgccgcgctgccggtc
aatcagctgatcatgatcaagctggcgctcaactcggcactgctgcagcaagggggggtc
aacagccggatgctcagcacggtgttcgacggcgtagctcggcacacccccgaggggcac
gcctttgtcgccgacgcggtcgagcatggcttccgggatgcggtgaaccatcgagacgag
ccgttcggagactacggccgccgggcgtcttcggtttga

DBGET integrated database retrieval system