KEGG   Mycobacterium ulcerans: MUL_0954Help
Entry
MUL_0954          CDS       T00435                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase DapE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00300  Lysine biosynthesis
mul01100  Metabolic pathways
mul01120  Microbial metabolism in diverse environments
mul01230  Biosynthesis of amino acids
Module
mul_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MUL_0954 (dapE)
Enzymes [BR:mul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MUL_0954 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 AlkA_N Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ABL03576
Pasteur: MUL_0954
UniProt: A0PMK7
Position
1000269..1001333
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIDLTAALIDIPSESRDEARIADEVEAALRAQTSGFEIIRNGNAVLARTRLNR
PSRVLLAGHLDTVPVADNLPSRRADGQLHGCGAADMKSGDAVFLHLAATVAEPVHDLTLV
FYDCEEIEAAANGLGRIERELPEWLSADVAILGEPTSGYIEAGCQGTLRVVISATGTRAH
SARSWLGDNAIHKLSAVLDRLARYPARSVDIDGCTYREGLSAVRVDGGVAGNVIPDAASV
TVNYRFAPDRSVPAALQHVREVFDGLDVQIEQTDAAAGALPGLAQPAAKALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHCRDERVPVATITTVADTLRRYLST
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacttgcgcggggacccgatcgacctgaccgctgcactgatcgacatccccagc
gaatctcgggatgaggcgcgcatcgccgatgaggtagaggcggcgttgcgtgcgcagaca
tcgggcttcgagatcatccgcaacggcaacgcggtgcttgcccggacccggctgaaccgg
ccctcgcgggtgctgctggccggacatttggacaccgtgccggtggccgacaacttgccc
agccgtcgcgccgacgggcagctgcacggctgtggcgcggccgatatgaagtccggtgac
gcggtgtttctgcatctggcggccacggtggccgaaccggtgcacgacctgacgctggtg
ttctacgactgtgaggaaatcgaggcggcggcaaacggtttggggcgcatcgagcgggag
ctcccggagtggctgtccgcagatgtcgccatcctgggagagcccacgtcgggctacata
gaagccggttgccagggcacgttacgagtggtcatcagcgcgaccgggacccgcgcgcac
tcggcgcgttcttggttgggggacaacgcaatccacaagctcagtgccgtgctggaccgg
ctggcgcgctacccggcgcgcagcgtcgacatcgacggttgcacataccgagagggtttg
tcggcggtacgcgtggacggtggcgtggcgggcaacgtgattccggacgcggcttcggta
acggtcaactatcgctttgcccccgaccggtcggttccggccgccctgcagcacgtgcgt
gaggtattcgacgggctcgacgtgcagatcgagcagaccgacgcggcggcgggcgcgctg
ccgggtctggcgcaacccgccgccaaagcactggttgaggctgccggtgggcaggtccga
gcgaaatacggctggacggatgtgtcccgcttcgcggctctgggcatccccgcggtcaat
tacggccccggggaccccaatctggcgcattgccgcgacgagcgagtgccggtcgccacg
atcaccactgtggcggacacgttgcgccgctacctgagcacctag

DBGET integrated database retrieval system