KEGG   Mycobacterium ulcerans: MUL_0958Help
Entry
MUL_0958          CDS       T00435                                 

Gene name
folP2
Definition
dihydropteroate synthase 2 FolP2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mul  Mycobacterium ulcerans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MUL_0958 (folP2)
Enzymes [BR:mul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MUL_0958 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1006098..1006973
Genome map
AA seq 291 aa AA seqDB search
MQATLCGRPVAGDRPLIMAIVNRTPDSFYDKGATFSDAAARDAVHRAVAEGADVIDVGGV
KAGPGQDVDPDTEIGRLVPFVEWLRDAYPEQVISVDTWRSEVARRACAAGADLINDTWAG
VDPAIVEVAAEFGAGLVCAHTGGARPRTRPFRVSYGTTTRGVVDDVIREVTAAAERAVAA
GVARDRVLIDPAHDFGKNTWHGLLLLRHVADLVKTGWPVLMALSNKDFVGETLGVDLTER
LEGTLAATALAAAAGARMFRVHEIAATRRVLEMVASIQGTRPPTRTVRGLA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcaacgctgtgtggccgcccggtggcaggggaccgcccgctgatcatggcgatc
gtgaaccgcaccccggactcgttctatgacaagggcgcgaccttttctgacgcggccgct
cgcgacgcggtacatcgagcggtcgccgaaggcgccgacgtcatcgacgtcggaggtgtc
aaggccgggcccggccaggacgtcgaccccgacaccgagatcggtcggttggtgccgttt
gtcgagtggctccgtgacgcctaccccgagcaggtgatcagcgtcgacacctggcgctcg
gaggtggcccggcgggcctgtgcggcaggtgcggacctgatcaacgacacctgggccggg
gttgaccccgcgatagtggaggtggccgccgaattcggtgcgggcctggtatgcgcgcac
accgggggagcgcgaccacgcacgcgtccctttcgggtgagttacggtacgactacccgc
ggcgtggtggacgacgtgattcgcgaggtcacagcggccgccgagcgggcggttgcggcc
ggagttgcccgcgaccgcgtgttgatcgatccagctcacgatttcggcaagaacacctgg
cacgggttgctgctgttgcggcacgtggccgatcttgttaagaccgggtggccggtactc
atggcgttgagcaacaaggactttgtcggagagactctgggcgtggatctgaccgaacgg
ctcgagggaacgctggcggccaccgcattggcggcggccgccggtgcgcgcatgtttcgg
gtgcatgagatcgcagcgacccgccgggtcctggaaatggtggcgtcgatccaggggacc
cgcccgccgacacgcacggtgaggggactcgcatga

DBGET integrated database retrieval system