KEGG   Mycobacterium ulcerans: MUL_1162Help
Entry
MUL_1162          CDS       T00435                                 

Gene name
lpqI
Definition
lipoprotein LpqI
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mul  Mycobacterium ulcerans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MUL_1162 (lpqI)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MUL_1162 (lpqI)
Enzymes [BR:mul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MUL_1162 (lpqI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1246153..1247346
Genome map
AA seq 397 aa AA seqDB search
MAFPRTLAVLAAASALVAACSHGGTRTGSSSTTTSAGASRSATSSTPMAAAAPRICADPA
AVPAAMPNVRDKLAQSLMVGVRDGDDARAVVTNYRVGGILIGSDTDLSILTNGVLKDIVA
GSGPLPVAVNVDEEGGRVSRLKSLLGGRGPSARELARTDTVDQVYDVALQRGRKMKELGI
TVDLAPVVDVTDAPDDTVIGDRSFGSNPETVTEYAGAYARGLRDAGLLPVLKHFPGHGRA
SGDSHTGGVVTPPLSDLQDSDLVPYRTLVTQTPVAVMLGHLQVPGLTGDEPASLSKNAVD
LLRNGTGYGGPPFDGPIFSDDLSSMAAISDRYGVTEAVLRSLQAGTDIALWVSTEEVPAV
LDRLEQALAAGELQMSAVDASLVRVARMKNVSASCGH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccgcgcacactggcggtacttgccgccgcgtcagcgctggtggcggcctgc
agccacggcggaacacgcaccggatcctcctcgaccacgacctcggcgggcgctagccgg
tcagccaccagctcgaccccgatggccgctgcggccccccggatttgtgctgaccccgcg
gccgtgccggcggcgatgcccaacgttcgagacaaactggcccagtcgctcatggtcggc
gtccgcgatggcgatgacgccagggccgtggtcaccaactaccgcgtgggcgggatcctc
atcggtagcgacaccgatttgtcgatcttgaccaacggtgtgctgaaggacatcgttgcc
ggctccggcccgctgccggtggcggtgaacgtcgacgaagaaggcggccgggtgtcccgg
ctgaagtcattgctcggaggccgggggccctcggcgcgggagctggcccgcaccgacacc
gtcgaccaggtctacgacgtggcgctgcagcggggccgcaagatgaaggagctgggcatc
accgttgacctggcgccggtggttgatgtcaccgatgccccggacgacaccgtgatcggg
gaccggtcgtttggttctaacccggagacggtcaccgaatatgccggtgcctacgcgcgc
ggcttgcgcgacgccgggctgttgccggtgctcaaacacttccccgggcacgggcgtgcc
tcgggtgattcgcacaccggcggggtcgttacgccgccgctgagtgacttgcaggacagc
gatctggtgccctatcggacgctggtgacccaaaccccggtggcggtgatgctcggccac
ctccaggtcccgggtctgaccggcgacgagccggccagcctcagcaagaacgcggtggac
ctgctgcgtaacggcaccggttatggcggaccgccgttcgatggcccgatcttcagtgac
gacctatccagcatggccgcgatctccgaccgctacggcgtgaccgaggcggtgctgcgc
agcttgcaggccggtaccgacatcgcattgtgggtaagtactgaagaggtgcccgccgtg
ctggatcggttggaacaggcgctggccgccggtgagctgcagatgtcggcggtcgacgca
tcattggtccgggtggcgcggatgaagaacgtcagcgccagctgtgggcactag

DBGET integrated database retrieval system