KEGG   Mycobacterium ulcerans: MUL_1183Help
Entry
MUL_1183          CDS       T00435                                 

Definition
(GenBank) transcriptional regulatory protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00860  Porphyrin and chlorophyll metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
Module
mul_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUL_1183
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MUL_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C TMEM213
Motif
Other DBs
NCBI-ProteinID: ABL03760
Pasteur: MUL_1183
UniProt: A0PN41
Position
complement(1268823..1269974)
Genome map
AA seq 383 aa AA seqDB search
MAQQKSEPLRGYRIAVTSSRRAEELCALLRRHGADVCSAPAINMIALPEDDELQGNTEAL
IANPPDILVAHTGIGFRGWVAAAEGWGLAGELVDALSVGRTISRGPKATGELRAAGLREE
WSPESESSQEVLEYLLESGVAGQRIAIQLHGAADGWDPFPEFVGGLRAAGAEVVPIRVSR
WKPTPLGGAFDQLVTEIARRQFDAVSFTSAPAAAAVLERGRELDIEEELLEALRNDVHAM
CVGPVTSRPLIRKGVPTSSPERLRLGALARHIAEELPLLGSCTVNAAGHVVDIRGTCVLV
DGSIKTLSGSGMAILRALTKRPGDVVARSELLNVLPGNGDDTHAVDTAVLRLRTALGDKN
IIATVVKRGYRLALDTQDDTACT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaaaaatctgagccgctgcggggctaccggattgcggtgacgtcttctcgc
cgggccgaggagttgtgcgcacttctgcgccgccacggtgccgacgtctgcagtgcccct
gcgatcaacatgatcgcgctgcccgaagacgacgaactccagggcaatacggaggcgttg
atcgccaacccacccgacatcctggtggcccacaccggtatcggtttccggggctgggta
gccgcggccgaggggtgggggctggccggcgaactcgttgatgcgttgtcggtaggccgg
accatatcgcgcggaccgaaggcgaccggcgagctacgcgcggcgggcttgcgcgaagaa
tggtcgccagaatcggaatcctcgcaagaagttctggaatacctgcttgaatccggggtc
gccggtcagcggatcgccattcagctacacggcgcggccgatggctgggatcccttcccc
gagtttgtcggcggcctccgcgcggcgggggccgaggttgtgcccattcgggtgtcccgc
tggaagccaacgccattgggcggcgcgttcgaccaattggtcaccgagatcgcccggcga
cagttcgacgcggtgagtttcacctctgcgcccgccgcggccgcggtgctcgagcgtggc
cgcgagctggatatcgaagaggaactgctggaggcgctgcgcaacgacgtacacgcgatg
tgcgtcggccccgtcacctctcgccccttgatccgcaagggggtgcccacctcatcgccg
gagcgactgcggctgggcgccttggcccgtcatatcgccgaggaacttccgctacttggc
tcctgcaccgtgaacgccgcaggccacgtcgtcgacatccgcggaacctgcgtgctcgtc
gatggctccatcaagacactgtcggggtcgggcatggcgatattgcgcgccttgaccaag
cgccccggagacgtcgtcgcccgcagcgagctgctgaatgtgcttcccggaaacggcgac
gacactcacgcggtagacaccgcagtattgcggctgcgcacggcgctgggcgacaaaaac
atcatcgcgacggtggtcaagcgtggttaccggctggcgctcgacacccaggacgacacc
gcatgcacctga

DBGET integrated database retrieval system