KEGG   Mycobacterium ulcerans: MUL_1183Help
Entry
MUL_1183          CDS       T00435                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mul  Mycobacterium ulcerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mul00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1268823..1269974)
Genome map
AA seq 383 aa AA seqDB search
MAQQKSEPLRGYRIAVTSSRRAEELCALLRRHGADVCSAPAINMIALPEDDELQGNTEAL
IANPPDILVAHTGIGFRGWVAAAEGWGLAGELVDALSVGRTISRGPKATGELRAAGLREE
WSPESESSQEVLEYLLESGVAGQRIAIQLHGAADGWDPFPEFVGGLRAAGAEVVPIRVSR
WKPTPLGGAFDQLVTEIARRQFDAVSFTSAPAAAAVLERGRELDIEEELLEALRNDVHAM
CVGPVTSRPLIRKGVPTSSPERLRLGALARHIAEELPLLGSCTVNAAGHVVDIRGTCVLV
DGSIKTLSGSGMAILRALTKRPGDVVARSELLNVLPGNGDDTHAVDTAVLRLRTALGDKN
IIATVVKRGYRLALDTQDDTACT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaaaaatctgagccgctgcggggctaccggattgcggtgacgtcttctcgc
cgggccgaggagttgtgcgcacttctgcgccgccacggtgccgacgtctgcagtgcccct
gcgatcaacatgatcgcgctgcccgaagacgacgaactccagggcaatacggaggcgttg
atcgccaacccacccgacatcctggtggcccacaccggtatcggtttccggggctgggta
gccgcggccgaggggtgggggctggccggcgaactcgttgatgcgttgtcggtaggccgg
accatatcgcgcggaccgaaggcgaccggcgagctacgcgcggcgggcttgcgcgaagaa
tggtcgccagaatcggaatcctcgcaagaagttctggaatacctgcttgaatccggggtc
gccggtcagcggatcgccattcagctacacggcgcggccgatggctgggatcccttcccc
gagtttgtcggcggcctccgcgcggcgggggccgaggttgtgcccattcgggtgtcccgc
tggaagccaacgccattgggcggcgcgttcgaccaattggtcaccgagatcgcccggcga
cagttcgacgcggtgagtttcacctctgcgcccgccgcggccgcggtgctcgagcgtggc
cgcgagctggatatcgaagaggaactgctggaggcgctgcgcaacgacgtacacgcgatg
tgcgtcggccccgtcacctctcgccccttgatccgcaagggggtgcccacctcatcgccg
gagcgactgcggctgggcgccttggcccgtcatatcgccgaggaacttccgctacttggc
tcctgcaccgtgaacgccgcaggccacgtcgtcgacatccgcggaacctgcgtgctcgtc
gatggctccatcaagacactgtcggggtcgggcatggcgatattgcgcgccttgaccaag
cgccccggagacgtcgtcgcccgcagcgagctgctgaatgtgcttcccggaaacggcgac
gacactcacgcggtagacaccgcagtattgcggctgcgcacggcgctgggcgacaaaaac
atcatcgcgacggtggtcaagcgtggttaccggctggcgctcgacacccaggacgacacc
gcatgcacctga

DBGET integrated database retrieval system