KEGG   Mycobacterium ulcerans: MUL_1365Help
Entry
MUL_1365          CDS       T00435                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mul  Mycobacterium ulcerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mul00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1472098..1473399)
Genome map
AA seq 433 aa AA seqDB search
MTDFEFDAPTVIRIKRDGGRLSDAAIDWVIDAYTEGRVAPEQMSALLMAIVLQGMDRGET
ARWTSAMLASGPRLDFSDLRAGGAPLVTVDKHSTGGVGDKITLPLVPVVVACGGTVPQAS
GRGLGHTGGTLDKLESISGLTATLSNQQVREQLCDVGAAIFAAGELAPADAKLYALRDIT
GTVESLPLIASSIMSKKLAEGAGALVLDVKVGSGAFLKSETQSRELAHTMVELGAAHGVP
TRALLTDMNCPLGSTVGNALEVAEALEVLDGGGPPDVVELTVRLAAEMLDLVGIDGRDPA
ETLRDGSAMDRFRRLIAAQGGELAKPLPIGAHSETVRAGRGGTMGDIDAMAVGLAAWRLG
AGRSRPGARVQHGAGIRIHRRPGEPVAAGEPLFTLYTDTPERFGAAVAELAAGFSVADSA
PTTRPLIIDRISR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgacttcgagttcgatgcaccgacggtgatccgcatcaagcgtgacggcggtcgg
ctgtccgatgccgctatcgactgggtgatcgacgcctacaccgagggccgggtcgcgccc
gaacagatgtcggcgctgctgatggcgattgtcttgcagggcatggaccgaggtgagacc
gcccggtggacatcggcgatgctggcgtcgggcccgcggttggacttctccgatctgcgc
gcgggcggtgctccgttggtgaccgtggacaagcactccaccggcggggtgggggacaag
atcacgctgccgctggtgcctgtcgtcgtcgcctgtgggggcactgtcccgcaggcgtcg
ggtcgtgggctcggccacaccggcggcaccctggacaaactggaatccatcagtggattg
accgcgacgctgtccaaccagcaggtgcgtgaacagctttgcgatgtcggcgccgcgatc
ttcgccgctggtgagctggcgcccgccgatgccaagctgtacgcgctgcgcgacatcacc
ggcaccgtggaatcgctgccgttgattgccagctcgatcatgagcaagaagctggccgag
ggggcgggcgcgctggtgctggacgtgaaggtcggctcgggagcgtttctgaaatccgaa
acccaatcacgtgaattggcacacaccatggtcgagctgggcgcggcacacggcgtgccc
acccgagcgctgctgaccgacatgaactgtccgttgggctcgaccgtcggcaatgcgctc
gaggtggccgaggcgctggaggtgctcgacggcggtgggccgcccgacgtggtggaactg
acggtgcggttggcagccgagatgctcgacctggttgggatcgatggccgcgacccggcc
gagacgctgcgcgacggctccgcgatggaccggtttcgccggctgatcgcggcccagggg
ggagagttggccaaaccgttgccgattggtgcgcattcggaaaccgtccgggccggccgc
ggcggcacaatgggcgacatcgatgcgatggcggtggggttggcggcatggcggctcggc
gcgggcaggtcccgccccggcgcacgggtccagcacggcgctggcattcggatccatcgg
cgaccgggggagccggtggcggccggtgagcccttgttcacgctctataccgacaccccc
gagcggttcggcgccgcggtagccgagctggccgccggcttcagcgtcgctgacagcgcg
ccgaccactcggcctctcatcattgatcggatcagccgatga

DBGET integrated database retrieval system