KEGG   Mycobacterium ulcerans: MUL_1368Help
Entry
MUL_1368          CDS       T00435                                 

Gene name
sdhD
Definition
succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mul  Mycobacterium ulcerans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_1368 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MUL_1368 (sdhD)
   00650 Butanoate metabolism
    MUL_1368 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MUL_1368 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1474462..1474884
Genome map
AA seq 140 aa AA seqDB search
MLQRSHDRPASLDNPRSPRRRASMPNFEKYAWLFMRFSGVVLVFLALGHLFIGLMWENGV
YRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGGNGLRVIIDDYSRKDSTRFWLNSLLVVS
IVFTLALGSYVLLTFDANIS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcagcgcagccacgaccggcccgccagcctggacaatccacgttcgccgcgtcgc
cgcgccagcatgcccaacttcgagaaatacgcctggctgttcatgcgattctccggcgta
gtgctggtgttcctggcgctggggcacttgttcatcgggctgatgtgggaaaacggggtc
taccgaatcgacttcaactacgtggcgcagcgctggtcgtccccgttctggcagacctgg
gatctgctgctgttgtggctggcacagttgcacggcggcaacgggctgcgagtcatcatc
gacgactacagccgcaaggattccactcgattctggctgaattcgctgctggtggtgtcg
atcgtgttcacgctggccctaggcagctacgtgctgttgacgttcgacgcgaacatctcc
tga

DBGET integrated database retrieval system