KEGG   Mycobacterium ulcerans: MUL_1592Help
Entry
MUL_1592          CDS       T00435                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00260  Glycine, serine and threonine metabolism
mul00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01130  Biosynthesis of antibiotics
mul01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUL_1592 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUL_1592 (trpB)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUL_1592 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: ABL04098
Pasteur: MUL_1592
UniProt: A0PP29
Position
1725487..1726764
Genome map
AA seq 425 aa AA seqDB search
MADLSRPDLPRTSSAIAERTSHDPDSGGHFGAYGGRYVPEALMAVIEEVAVAYEKERVNQ
DFLDTLDRLQTHYAGRPSPLYEATRLSAHAGSARIFLKREDLNHTGSHKINNVLGQALLA
RRMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGAEVVA
VETGSKTLKDAINEAFRDWVTNADRTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQG
QAGKLPDAVVACVGGGSNAIGIFHAFLDDPDVRLVGFEAAGDGVETGRHAATFAGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKDIGRVTYQPITDSEAMEAFGL
LCRMEGIIPAIESAHAVAGALKLGRELGKGAVIVVNLSGRGDKDVETAAKWFGLLTPGGS
ANKSV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctatctcgcccggacctgccgcggaccagttccgcgattgcagaacggacc
tcccacgatcccgattcaggcgggcatttcggcgcctacggtggccgttacgtcccagag
gcgctcatggcggtgatcgaagaggtcgccgtcgcgtacgagaaagagcgggtaaaccag
gacttcctggacacgctcgatcggctgcaaacgcactacgccggtcggccgtcgccgctg
tacgaagccaccaggctcagcgcgcacgctggctcagctcgaatcttcctgaagcgagaa
gacctaaaccacaccggctctcacaaaatcaacaatgtgctcggtcaggcattgctggcc
cgccggatggggaagacccgggtgatcgccgagaccggcgccggacagcatggtgtggct
acggccaccgcgtgtgcgctgctgggcctggaatgtgtcatctacatgggggccgttgac
accgcgcgtcaggcgctcaacgtagccaggatgcggttgctcggcgctgaggtcgtcgcc
gtggaaaccggttcaaaaaccctcaaagacgccatcaatgaggcattccgggattgggtc
accaacgccgatcgcacctactactgctttggtaccgcggctgggccccatcccttcccg
accatggttcgcgattttcagcggatcatcggcatggaggctcgtgtgcagatccaaggt
caggcgggcaagctgcctgatgcggtcgtggcatgcgtcggtggagggtccaatgcaatc
gggatctttcatgcatttctcgacgatcccgatgttcgattggtgggatttgaggcggca
ggcgacggcgtcgagacgggtcggcacgcggcgacgtttgccggtggttcgcccggagcg
ttccagggctccttctcctacttgctgcaggacgaagacggtcaaaccatcgaatcccat
tcgatctcagcgggtctggactatcccggggtcggccccgaacatgcctggctcaaggac
atcgggcgcgtcacttaccagccgattaccgactccgaggcgatggaggcattcggcctg
ctatgccggatggaaggcatcatccccgccatcgaatccgcccatgcggtggccggtgct
ctcaagctgggtcgtgagctgggaaagggtgcggtgattgtggtgaatttgtcggggcgg
ggcgacaaggatgtcgaaacggccgccaaatggttcggtctgctgacgcctggcggcagc
gcgaacaagtcggtttga

DBGET integrated database retrieval system