KEGG   Mycobacterium ulcerans: MUL_1593Help
Entry
MUL_1593          CDS       T00435                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00260  Glycine, serine and threonine metabolism
mul00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01130  Biosynthesis of antibiotics
mul01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUL_1593 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUL_1593 (trpA)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUL_1593 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABL04099
Pasteur: MUL_1593
UniProt: A0PP30
Position
1726767..1727576
Genome map
AA seq 269 aa AA seqDB search
MTVEQREASRLGPLFDSCRAENRAALIGYLPTGYPDVNTSVRAMTELVESGCDIVEVGVP
YSDPGMDGPTIQRATEAALSGGVRVRDALTAVESISKAGGRAVVMTYWNPVLRYGGDAFA
RDLAAAGGHGLITPDLIPDEAQQWLAASDAHGLDRIFLVAPSSTPERLANTVAASRGFVY
AASTMGVTGARDAVSNAAPDLVARVKAVSDIPVGVGLGVRSREQAAEIGRYADGVIVGSA
LVSALGDGLPSLRSLTEELAAGVRQRKSP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgaacaacgcgaagccagcaggctgggaccgcttttcgattcgtgccgcgca
gaaaatcgcgcggcgttgatcggatatctgcccaccggttaccccgacgtgaacacatcg
gtgcgagcgatgactgagctcgtcgaatcaggttgcgacatagtcgaagtcggcgttccc
tactcggatccgggcatggatggcccgactatccagcgggctaccgaggcggcgctgagc
gggggagtgcgagtccgggacgcgttgaccgcggtcgaatcgataagcaaggccggcggg
cgtgccgttgtgatgacgtactggaacccggtgctgcggtacgggggcgatgcattcgca
cgggatctggcggccgccggcgggcacgggctgatcactcccgacctcatccccgacgag
gcccaacagtggcttgccgcctccgatgcacacgggctggaccgcatctttctagtggcg
ccgtcgtcaacacccgaacgcctggcgaacaccgtcgcggcgtcacgcgggtttgtatat
gccgcgtcgaccatgggggtgaccggcgcgcgcgacgctgtgtcgaacgctgcgcccgat
ctggtggcgagggtcaaggcggtgtctgacatacccgtcggtgttggtttgggggtgcgg
tcgcgggaacaggccgccgagatcggccgctacgccgacggtgtcatcgtgggatcggcg
ttggtatcggcgttgggcgacggattgccgagtttgcgctcgctgacggaggaacttgcc
gctggcgttcgccagaggaagtcgccatga

DBGET integrated database retrieval system