KEGG   Mycobacterium ulcerans: MUL_1593Help
Entry
MUL_1593          CDS       T00435                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MUL_1593 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUL_1593 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUL_1593 (trpA)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUL_1593 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1726767..1727576
Genome map
AA seq 269 aa AA seqDB search
MTVEQREASRLGPLFDSCRAENRAALIGYLPTGYPDVNTSVRAMTELVESGCDIVEVGVP
YSDPGMDGPTIQRATEAALSGGVRVRDALTAVESISKAGGRAVVMTYWNPVLRYGGDAFA
RDLAAAGGHGLITPDLIPDEAQQWLAASDAHGLDRIFLVAPSSTPERLANTVAASRGFVY
AASTMGVTGARDAVSNAAPDLVARVKAVSDIPVGVGLGVRSREQAAEIGRYADGVIVGSA
LVSALGDGLPSLRSLTEELAAGVRQRKSP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgaacaacgcgaagccagcaggctgggaccgcttttcgattcgtgccgcgca
gaaaatcgcgcggcgttgatcggatatctgcccaccggttaccccgacgtgaacacatcg
gtgcgagcgatgactgagctcgtcgaatcaggttgcgacatagtcgaagtcggcgttccc
tactcggatccgggcatggatggcccgactatccagcgggctaccgaggcggcgctgagc
gggggagtgcgagtccgggacgcgttgaccgcggtcgaatcgataagcaaggccggcggg
cgtgccgttgtgatgacgtactggaacccggtgctgcggtacgggggcgatgcattcgca
cgggatctggcggccgccggcgggcacgggctgatcactcccgacctcatccccgacgag
gcccaacagtggcttgccgcctccgatgcacacgggctggaccgcatctttctagtggcg
ccgtcgtcaacacccgaacgcctggcgaacaccgtcgcggcgtcacgcgggtttgtatat
gccgcgtcgaccatgggggtgaccggcgcgcgcgacgctgtgtcgaacgctgcgcccgat
ctggtggcgagggtcaaggcggtgtctgacatacccgtcggtgttggtttgggggtgcgg
tcgcgggaacaggccgccgagatcggccgctacgccgacggtgtcatcgtgggatcggcg
ttggtatcggcgttgggcgacggattgccgagtttgcgctcgctgacggaggaacttgcc
gctggcgttcgccagaggaagtcgccatga

DBGET integrated database retrieval system