KEGG   Mycobacterium ulcerans: MUL_1659Help
Entry
MUL_1659          CDS       T00435                                 

Gene name
aao_1
Definition
D-amino acid oxidase Aao
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mul00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mul00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mul00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:mul00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1826160..1827272
Genome map
AA seq 370 aa AA seqDB search
MTPGDRPRVVVIGAGVSGWTTAMVLAKRGWQVVVAADGFGIDAVSSASGAMWEWPLSRCG
RYHDQAVLARYAGWAMRSYLRFAQLASDPGTGVGLRPAVYYFGRRIEDDPIEFAKMSEVK
RFVPRFVHDPALIDRHGVNRDSGVIDAYSYLAPTIDTDWYLAWLAREAKNAGVCVDRRRI
FGPLINQENRLLTEYRAESIINCAGLGARELAEDTTVVPHRGALLRVLQERTATSRVTAA
DVVANDAATDQQNLISIVPRGSDQLVLGGLVEPDRYHTELNLADYPPLRMMFDRCVEFLP
ALRSAAPDVIHPVRVGLRPFRRDGVRLEAQRGTRIVHNYGHGGAGISLSWGCAQEVADLA
YRIFARQGVA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccggggaccggccacgggtcgtggtcatcggggccggtgtgagcggatggacc
accgcgatggtgctggccaagcggggttggcaggtcgtcgtcgcggccgacgggttcggc
attgacgcggtgtcctcggcgtccggggcgatgtgggagtggccgctgtcgcggtgcggc
cgctaccacgaccaggcggtattggctcgatacgcgggttgggcgatgcgttcctacctg
cgcttcgcccagctcgcctcggatccgggtaccggggtgggcctgaggccggcggtgtac
tacttcggccggcgcatcgaggacgacccgatcgagttcgcgaagatgtccgaggtgaag
cgatttgtcccccggttcgtccacgacccggcgctgatcgataggcatggcgtcaaccgg
gactccggtgtgatcgacgcctattcctacctggcacccaccattgataccgactggtat
ctggcctggcttgctcgcgaggccaagaatgcgggcgtctgcgtcgaccgccgacggatc
ttcggcccgctgatcaatcaggaaaatcggctgctgaccgaatatcgtgccgaatcgatc
atcaactgcgcgggactgggcgcgcgagagctggccgaggacacgaccgtggttccgcac
cgcggcgcgctgctgcgggtgctgcaggaacgtaccgcgacctcgcgggtaaccgcagct
gacgtggtggcaaacgatgccgctaccgaccagcagaacctgatctcgatcgtgcctcgc
ggatcggatcagctggtgctgggcgggctcgtcgagccggaccgataccacaccgaattg
aacctggctgactatccgccgttgcgcatgatgttcgatcgctgcgtcgagttcttgccg
gcattgcgcagcgctgcaccagacgtgattcatccggtacgggtcgggttgcgccccttc
cgccgcgacggagtgcggctggaagcccagcgtggcactcggatcgtgcacaactacggt
catggtggcgccggcatcagcctctcctggggatgtgcccaggaggttgccgatctggcc
taccgaatattcgccagacagggcgttgcctga

DBGET integrated database retrieval system