KEGG   Mycobacterium ulcerans: MUL_1691Help
Entry
MUL_1691          CDS       T00435                                 

Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mul  Mycobacterium ulcerans
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mul00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1862426..1863019)
Genome map
AA seq 197 aa AA seqDB search
MLATIDKFAYEKSILVNVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPQAK
VYSVELAEANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALATEHGFAPGALDFVFV
DHDKKAYLDDLQSILDREWLHRGSIVVADNVKVPGAPEYHEYMRHHQGTLWDTTEHKTHL
EYQTLVSDLVLESDYLG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctacgaaaagtccatcctggtcaacgtcggcgac
gagaagggactactactcgatgccgcggtgcggcgcgccgatccggcactggcgctggag
ctgggtacctactgcgggtatggcgcgctgcggatcgcgcgggccgcaccgcaggccaag
gtgtactccgtcgaactcgccgaagccaacgccgccaacgcccggcagatctgggctcat
gccggcgttgccgatcgcgtgacatgtgtcgtgggcaccattggcgacggcggacgcacc
ctggacgcactcgcgaccgagcacggattcgcccccggtgcgctcgatttcgtctttgtc
gatcacgacaagaaggcctacctcgacgacctgcaaagcatcctggaccgggagtggctg
catcggggctcgatcgtggtggccgacaacgtcaaggtgcccggcgctcccgagtaccac
gaatacatgcggcaccatcagggcacgctatgggacaccaccgagcacaagacccacctc
gagtaccagaccctggtatcggatctggtgctcgaatccgactacttggggtga

DBGET integrated database retrieval system