KEGG   Mycobacterium ulcerans: MUL_1691Help
Entry
MUL_1691          CDS       T00435                                 

Definition
(GenBank) O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00350  Tyrosine metabolism
mul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUL_1691
Enzymes [BR:mul01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MUL_1691
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MUL_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_25 Methyltransf_31 DUF531 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: ABL04180
Pasteur: MUL_1691
UniProt: A0PPB1
Position
complement(1862426..1863019)
Genome map
AA seq 197 aa AA seqDB search
MLATIDKFAYEKSILVNVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPQAK
VYSVELAEANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALATEHGFAPGALDFVFV
DHDKKAYLDDLQSILDREWLHRGSIVVADNVKVPGAPEYHEYMRHHQGTLWDTTEHKTHL
EYQTLVSDLVLESDYLG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctacgaaaagtccatcctggtcaacgtcggcgac
gagaagggactactactcgatgccgcggtgcggcgcgccgatccggcactggcgctggag
ctgggtacctactgcgggtatggcgcgctgcggatcgcgcgggccgcaccgcaggccaag
gtgtactccgtcgaactcgccgaagccaacgccgccaacgcccggcagatctgggctcat
gccggcgttgccgatcgcgtgacatgtgtcgtgggcaccattggcgacggcggacgcacc
ctggacgcactcgcgaccgagcacggattcgcccccggtgcgctcgatttcgtctttgtc
gatcacgacaagaaggcctacctcgacgacctgcaaagcatcctggaccgggagtggctg
catcggggctcgatcgtggtggccgacaacgtcaaggtgcccggcgctcccgagtaccac
gaatacatgcggcaccatcagggcacgctatgggacaccaccgagcacaagacccacctc
gagtaccagaccctggtatcggatctggtgctcgaatccgactacttggggtga

DBGET integrated database retrieval system