KEGG   Mycobacterium ulcerans: MUL_1780Help
Entry
MUL_1780          CDS       T00435                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase PyrB
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00240  Pyrimidine metabolism
mul00250  Alanine, aspartate and glutamate metabolism
mul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MUL_1780 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MUL_1780 (pyrB)
Enzymes [BR:mul01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MUL_1780 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABL04257
Pasteur: MUL_1780
UniProt: A0PPI8
Position
1966699..1967661
Genome map
AA seq 320 aa AA seqDB search
MTPRHLLAAGDLSRDDAIAILDDADRFAQALVGREVKKLPTLRGRTVVTMFYENSTRTRV
SFEVAGKWMSADLINVSASGSSVSKGESLRDTALTLRAAGADALIIRHPASGAARLFADW
TAGQSDGGPSVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRVVIVGDILHSRVARSNV
TLLHTLGAEVVLVAPPTLLPVGVADWPVTVSHDLDAELPAADAVLMLRVQAERMNGGFFP
SVREYSTLYGLSDRRQAMLGGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHIR
MAVLFHVLVGLESAGEEGAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaggcatctgctggcggcgggcgacttgagccgcgacgacgccattgcgatc
cttgacgacgccgaccgcttcgcgcaggccctggttggccgtgaggtcaagaagttgccg
acgctgcgcggtcgcaccgtggtgacgatgttttacgagaactcgacacgaacccgggtg
tccttcgaggtggccggtaagtggatgagcgcggacttgatcaatgtcagcgcgagcggg
tcctcggtcagcaagggcgagtcgctgcgcgacaccgcgctgaccctgcgtgcggctggc
gccgacgccctgatcatccggcaccccgcgtccggggcggcgcggctgttcgccgattgg
accgccggccaatccgacggtggcccttcggtgatcaacgccggcgacggcactcacgag
cacccgacgcaggcgctgctggacgccctgaccatccggcagcggctcggtggcatcgag
ggccggcgcgtcgtcatcgtcggcgacatcctgcacagccgggtggcccgctccaacgtc
acgctgctgcacacgctgggtgccgaggtggtgctggtggcgccacccaccttgctgccg
gtgggtgtcgcggattggccggtcaccgtatcccatgaccttgacgccgagcttcccgcc
gccgacgcggtgctgatgctgcgggtgcaggccgagcggatgaacggcggattcttcccc
tcggtgcgggagtactcgaccttgtacggtctgtccgaccgtcggcaggcgatgctgggc
ggtcacgcggtggtgctgcatcccgggccgatgctgcgcggcatggagatcgcctcatcg
gttgccgactcgtcacagtcggctgtgttgcaacaggtttccaacggagtccacatacgc
atggcggtgctgttccatgtcctggttggactcgagtcggctggggaagagggtgcggcg
tga

DBGET integrated database retrieval system