KEGG   Mycobacterium ulcerans: MUL_1830Help
Entry
MUL_1830          CDS       T00435                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_1830 (tpiA)
   01230 Biosynthesis of amino acids
    MUL_1830 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_1830 (tpiA)
   00051 Fructose and mannose metabolism
    MUL_1830 (tpiA)
   00562 Inositol phosphate metabolism
    MUL_1830 (tpiA)
Enzymes [BR:mul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MUL_1830 (tpiA)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MUL_1830 (tpiA)
  Exosomal proteins of bladder cancer cells
   MUL_1830 (tpiA)
  Exosomal proteins of melanoma cells
   MUL_1830 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2022925..2023710
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYYDKVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDSGAYTGDISGAFLAKLGCSFVVVGHSERRTYHNEDDALVAAKAAA
ALKHDLTPIVCIGEHLDVREAGNHVAHNVEQLRGSLSGLSAEQISKVVIAYEPVWAIGTG
RVAGAADAQEVCAAIRSELGSLASPQIADAVRVLYGGSVNAKNIGELIAQADVDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgttgatcgccggcaactggaagatgaacctcaatcacttcgaggcg
atcgctctggtgcagaagatcgcattctcgttgccggacaagtactacgacaaagtcgat
gtgacggtcattccgccgttcaccgacttgcgtagtgtacagaccttggtcgacggtgac
aagctgcgcctgacctatggcggtcaagacctgtcccagcacgactccggtgcctatacc
ggtgacatcagtggggcatttctggccaaactgggctgcagcttcgtcgtcgtggggcat
tcggaacggcgcacctaccacaacgaggacgacgctctagtggccgccaaggctgccgcg
gcgctcaagcacgacctgactccgatcgtctgcatcggcgagcacctcgatgtgcgtgag
gcgggaaatcacgtggcgcacaacgtcgaacaactgcgcggttcgctgtccgggctttca
gcagagcagatcagcaaggtggtcatcgcctacgagccggtctgggcgatcggcaccggg
cgggtagccggcgcagccgacgcccaggaagtctgtgcggcaatccgcagcgagcttggt
tcgctggcctcgccgcagatcgctgacgcggttcgggtgctctacggcggctcggtcaac
gcgaagaacatcggcgaactgatcgcgcaggcggacgtcgacggtggcctggtgggtggc
gcgtcgttggacggtgaacagtttgcgacgctggcggccatcgccgccgggggaccgctg
ccgtaa

DBGET integrated database retrieval system