KEGG   Mycobacterium ulcerans: MUL_2085Help
Entry
MUL_2085          CDS       T00435                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mul  Mycobacterium ulcerans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mul00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2331209..2332417
Genome map
AA seq 402 aa AA seqDB search
MTTATDGFADGRLRVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGGSNLDTLRRQRAE
TGVTEIAIADERAAQLAGDIAYQEPDAVTRLVEETEADVVLNALVGALGLRPTLAALASG
ARLALANKESLVAGGPLVLQAAQPGQIVPVDSEHSALAQCLRAGTPDEVAKLVLTASGGP
FRGWSAADLQEVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGISYERIEVV
VHPQSIVHSMVTFVDGSTIAQASPPDMKLPISLALGWPRRVPGAARYCDFSQAQTWEFEP
LDDEVFPAVELARHAGETGGCMTAVYNAANEEAAAAFLAGRISFPAIVGTIADVLHAADQ
WAVSPANVDDVLDAQRWARQRAQRAIAKASPAGACEKVSGLA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgactactgccaccgacgggttcgccgacggccgcttgcgcgtgctagtgctgggcagc
acgggttcgatcggcacccaggcgctggaagtcatcgccgccaatccggaccgtttcgag
gtcgtcgggctggctgccgggggcagcaatctggacacgctgcggcgacagcgcgccgag
accggcgtaacggagattgcgatcgccgacgagcgggcggcgcaactggccggcgacatt
gcgtaccaggagcccgacgctgtcacccggctggtggaggagaccgaggccgacgtcgtc
ctcaacgcgctcgtcggcgcattgggcctgcgcccgacgctggccgcgctggcatccggg
gccaggctggccttggccaacaaggaatcgctggttgccggcggtccactggtactgcag
gccgcgcaacccggtcagatcgtgccggtcgactccgagcattccgcgctggctcagtgc
ttgcgcgcaggcacccccgacgaagtcgccaaactagtgttgaccgcctcgggtgggccg
tttcgggggtggtcggcggccgacctccaggaggtcaccccggagcaggccggtgcccat
ccgacctggtcaatgggcccgatgaatacgctgaactcggcctcactggtcaacaaggga
ctcgagctcatcgaaacccacctactgttcggcatctcgtacgagcgcatcgaggtcgtc
gtgcatccgcagtcgatcgtgcattccatggtcaccttcgtcgacggttcgaccatcgcc
caggccagccccccggacatgaaattgccgatctcgctggcgttgggctggccgcgccgg
gtgccgggtgcggcccgttattgcgatttcagtcaggctcagacgtgggagttcgagccg
ctggacgacgaggtgtttcccgccgtcgagctggctcgccatgccggcgagaccggcggg
tgcatgaccgcggtgtacaacgcggccaacgaagaagcggcagcggccttcctcgccggc
cggatcagtttccccgccatcgtgggaactatcgccgacgtgctgcacgctgccgaccaa
tgggccgtttcacccgctaacgtggatgacgtacttgacgcgcagcgttgggcgcggcag
cgggcacagcgtgcgatcgccaaagcaagcccggccggcgcatgcgagaaggtctccgga
ctggcttga

DBGET integrated database retrieval system