KEGG   Mycobacterium ulcerans: MUL_2111Help
Entry
MUL_2111          CDS       T00435                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mul00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2356993..2358843
Genome map
AA seq 616 aa AA seqDB search
MKAYPFSAIVGHGPMRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAALLSAATGSSG
PGLVEMPLGATEDRVVGSLDLQRVLRDGEHAFAPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVDV
RVEVIRQRMAFEADPDAFCERYVGPDAELARRIAEARDIVDTVVLPDHELRRIAALCAAF
DVDGMRADLVLARTATAHAAWRGAPAVEEQDVRVAAELALPHRRRRDPFDDHGIDRDQLD
EALARAGAESQGSPEPEPDPPGGGQSAGQDCPPQQQNSNSRPQQAPKPSAGPSKVFRTRA
LVVPGVGEGAPGRRSRARNGSGSVVAAADGSDSNSGARGLHLFATLLSAAENATGSGPLR
PQGADIRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATMSLLRDAYQRRDKVAVIT
FRQHEAKILLSPTSSAHIASRRLARFDTGGKTPLAEGLLAARELVIREKVRDRARRPLVV
VLTDGRATAGPDPLGRSRIAAARLVAEGATAVVVDCETSYVRLGLAQQLARHLGAPAVRL
EQLHADYLAQAIRSVA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctatccattcagcgcgatcgttggacacggcccgatgcgactggcgttgctg
ttgtgcgccgttcgtccggagataggcggcgtgctcattcgcggcgagaagggcaccgcg
aaatcaacagccgtgcgcgggctcgccgcgctactgtccgccgctaccggcagttccggt
cccgggctggtcgaaatgccgctgggagccaccgaggaccgggtggtcggctcgctggac
ctgcagcgcgtcttgcgcgatggcgaacacgccttcgcgccgggactgctggcccgcgcc
cacgggggagtgctctacgtcgacgaagtgaacttgctgcacgatcatctggtcgacatc
ttgctcgacgccgccgcgatggggcgggtgcacgtcgaacgggacggcatctcacattcg
cacgaggcccgcttcgtcctgatcggcacgatgaatcccgaagaaggcgaactgcgtcca
caactgctggaccggttcgggctgaccgtcgacgtgcacgcgtcccgcgatgtggacgtc
cgcgtggaagtcattcgccagcggatggcttttgaagccgacccggacgccttctgtgaa
cgctatgtcggccccgacgccgagctggcccgccgtatcgccgaggcgcgggacatcgtc
gacacggtcgtgttgcccgaccacgaattgcgccggatcgccgcgttgtgcgcggcgttc
gacgtcgatggcatgcgagcggatctggtgctggcccgaacggccaccgctcatgcggcg
tggcgcggcgcaccggccgtcgaagaacaagacgtgcgggtcgccgcggaactggcattg
ccccatcgccgtcgtcgggacccattcgacgatcacggtattgaccgcgaccagctcgac
gaggcactggcacgggccggagcggagtcgcagggttcgcccgagccggagcccgacccg
ccgggtggaggccagtcagccggccaggattgccctccccaacaacagaactcgaactcc
aggccccagcaggcgcccaagcccagcgccgggccgtccaaggtgttccgcacccgcgcg
ctggttgtgcccggggtcggcgaaggtgcgcccgggcggcgctcgcgggcgcgcaacggc
tccggcagcgtggtagcggccgccgacggtagtgacagcaattccggcgcccgtgggttg
cacctgttcgccaccttgctctcggccgccgaaaacgccaccggatcggggccgctgcgc
ccgcagggcgccgacatccgccgggcggtgcgcgaggggcgtgagggcaacctggtgatc
ttcgtcgtggacgcttcgggatcgatggctgcccgggatcggatggcggcggtcagcggc
gcgaccatgtcgctgctgcgcgatgcctaccagcgccgggacaaggtcgcggtgatcacg
ttccgccagcatgaagccaagatcctgctgtcacccacctcgtcggcgcacatcgccagc
cggcggctggcccggttcgacaccggcggcaagactccgctggccgagggtctgctggcc
gcgcgcgagctggtgatccgggagaaagtacgcgaccgtgcccgccgcccgctggtggtg
gtgctcaccgatggacgggccaccgccgggccggacccgttgggccgcagccgaatcgcc
gccgctcggcttgtcgccgaaggcgccaccgcggtggttgtggactgcgagacgtcgtat
gtgcggctcggactggcccagcaactcgcccgccatctcggcgcgccggcggtgcggctc
gaacagttgcacgccgactacttggcgcaagccatccgcagcgtggcctga

DBGET integrated database retrieval system