KEGG   Mycobacterium ulcerans: MUL_2233Help
Entry
MUL_2233          CDS       T00435                                 

Gene name
folE_1
Definition
GTP cyclohydrolase I FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mul  Mycobacterium ulcerans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mul00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2489971..2490417
Genome map
AA seq 148 aa AA seqDB search
MLWGYHEVPEDQLATDFPAPDDPGMIVMHGISFSSTCPHHLLPFTGTATIAYRPHPGQRI
VGLSKLARLVDGYAARLQVQERIGQQAVDGIMRRLNPSGAMCIITARHDCMRLRGVRDPA
AEATTEARKGIWSDHEMALIHRLHGGAR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggggatatcacgaggtaccggaggaccagctcgctaccgactttcccgctccc
gatgacccgggaatgatcgtcatgcatggcatttcgttctcctccacctgcccacaccat
ctcttgccgttcaccggcaccgccacgatcgcctaccgcccgcatccgggccagcgcatc
gtcggcttgtccaaactggcccggctggtggacggttacgccgcacggctgcaggtacaa
gagcgcatcggacagcaagcggtggacggaataatgcgcaggctcaacccctccggagcc
atgtgcatcatcaccgccagacacgattgcatgcgactgcgcggggtacgcgatccggcc
gccgaggcgactaccgaagcgcgaaaaggtatttggtcagatcatgaaatggcgttgatt
catcgcctgcacggcggagcccgctga

DBGET integrated database retrieval system