KEGG   Mycobacterium ulcerans: MUL_2436Help
Entry
MUL_2436          CDS       T00435                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mul  Mycobacterium ulcerans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MUL_2436 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_2436 (mhpF)
   00650 Butanoate metabolism
    MUL_2436 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MUL_2436 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_2436 (mhpF)
   00622 Xylene degradation
    MUL_2436 (mhpF)
   00621 Dioxin degradation
    MUL_2436 (mhpF)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MUL_2436 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2722788..2723735)
Genome map
AA seq 315 aa AA seqDB search
MDNWPVAIIGSGVVGTDLMSRIGNGDGRLRVSAMVGTNPHCDGLARAAAAGISTSPGGVD
GLLSMPEFANIRLVFDTTNPGAHQSNWARLADTGVRMLDLTASAIGPCCVPAVNLDAQLD
APNLSMATCSAQAAVPIVAAVRRHGVVRYAEVVSAIASQALGPAERVTLDEFAELTTTAV
QELGGARRAKTLTIVNPADPPMPMRTTVFCLVDQADEVARNEADVLAVVDGVQALLPGYR
LKHRVQFERLGSGNTLYIPGTGEFGGTRITVLLEITAAGGYLPACAGNVAIVTSAAKATA
EAIVERHAQTLKAKI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggacaactggccggtggcgatcatcggctccggtgttgtcggcaccgatctgatgagc
aggatcggcaatggcgacggacggctgcgggtgagcgcgatggttggcaccaacccgcac
tgtgacggcctggcccgggcggccgccgcagggatctcgaccagcccaggtggggttgac
gggctgctgagcatgcccgagtttgcgaatatccgcctggttttcgacaccaccaacccc
ggcgcacaccagagcaattgggcgcggctggccgataccggcgtacggatgctcgacctc
accgcgtccgcgatcggcccatgctgcgtgccggcagtcaatctcgatgcccagctcgac
gcgccgaacctgagcatggcgacctgcagcgcacaggcggcggtgcccatcgtcgccgcg
gtgcgccggcacggggtggtgcgctatgccgaagttgtttctgccatcgcctcgcaggcc
ctggggccggctgagcgggtgaccctcgatgaattcgccgaactgaccacgaccgcggtc
caagagctcggtggcgcgcgccgggccaagacgctcacgatcgtcaaccccgccgatcca
ccgatgccgatgcgcaccaccgtcttctgcctggttgaccaagctgacgaggtggctcgg
aacgaggcggacgtactggccgtggtcgacggagtccaagccttgctgcccggctaccgg
ctcaagcatcgcgtgcaattcgagcggttgggcagcggcaacacgctctacattccgggg
acgggggagttcggtggcactcggatcaccgttctgctcgagatcaccgctgccgggggc
tacctgccagcctgcgccggaaacgtcgcgatcgtgacgtcggcggccaaggccaccgcc
gaggcgatcgtcgaacgccacgctcaaacgctaaaggcgaaaatatga

DBGET integrated database retrieval system