KEGG   Mycobacterium ulcerans: MUL_2730Help
Entry
MUL_2730          CDS       T00435                                 

Gene name
cysQ_1
Definition
monophosphatase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mul  Mycobacterium ulcerans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MUL_2730 (cysQ_1)
Enzymes [BR:mul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MUL_2730 (cysQ_1)
Transfer RNA biogenesis [BR:mul03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MUL_2730 (cysQ_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3049487..3050215)
Genome map
AA seq 242 aa AA seqDB search
MNDHAVAAWLATEAGRLLLGVREEFAAAEGAQRKAAGDKRSHDFLMDKLAAERPGDAVLS
EEGADDPVRLRSERVWIVDPLDGTREFSELGRVDWAVHVALWQAGQLVAGAVALPAQDIT
LATPHVEPPPAAPDRPRIVVSRTRPPAIALAVRDALDGTLVEMGSAGAKVASVVQGLADV
YVHAGGQFEWDSAAPVAVARSAGLHTSRIDGSALTYNRPDPKLPDLVVCRPELATAVLAA
TG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccacgctgtggctgcgtggctggccaccgaggcaggtcgcctgctgctcgga
gtgcgggaggagttcgccgcagccgagggtgcccagcgtaaggcggcgggggacaagcga
tctcatgactttctgatggacaagctggccgccgagcgtcccggggacgcggtgctctcc
gaggagggtgccgacgaccccgtccggctacgcagcgagcgagtctggatcgttgatccg
ctcgacggcacccgcgaattctccgaactcggccgcgtcgactgggcggtgcatgtcgcg
ctgtggcaggccggccagctcgtcgccggggccgtggcgctcccggcgcaggacatcacc
ttggcgacaccacacgtcgagccacccccggcggcacccgacaggccgcgcatcgtggtt
tcgcggactcgtccaccggccatcgcgctggctgtgcgcgacgcgttggatggcaccttg
gtggaaatgggctctgccggggccaaggtggcatcggtcgtgcagggcttggccgatgtg
tatgtccatgccggcgggcagttcgagtgggactcggccgccccggtggcggtggcccga
tccgctgggctgcatacgtctcgtatcgacgggtcggcattgacctacaaccggccggac
cccaagcttcccgatttggtggtatgccgccccgagctcgctaccgccgtgctggctgct
accggctga

DBGET integrated database retrieval system