KEGG   Mycobacterium ulcerans: MUL_2943Help
Entry
MUL_2943          CDS       T00435                                 

Gene name
aceAb
Definition
isocitrate lyase AceAb
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_2943 (aceAb)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MUL_2943 (aceAb)
Enzymes [BR:mul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MUL_2943 (aceAb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3264294..3266582
Genome map
AA seq 762 aa AA seqDB search
MAIVETDTEIRTPFEQEVADTQRYFDSSRFAGIVRLYTARQVVEQRGTIPNDYTVARTAA
GVFYQRLRELYAEKKSVTTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQEYLRLQMTDQQRATTTAYDFRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQLDVMR
VPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDIPSYKSCFLAMLRRFYELGVKELN
GHLLYALADAEYAAANGWLERSGIMGLISDAVNSWREDGMQTTDDLFDQVESRFVAAWED
DAGLMTYAEAVAEVLAFGQSEGDPVPMSPEEWRTFAARASLYAARQKAKEMGVDPGWDCE
LAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQML
AYNLSPSFNWDTTGMTDEEMKRFPEELGKMGFVFNFITYGGHQIDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVAGPRSDAALQASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEERLALWSDHYQLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVFDPIKD
RHGRSILTVRDQNTFAHKLRQKRLMTLIHLWLVHRFKADAVYYVTPTEDNQYQTSKMKSH
GIFSEVNQDVGEIIVAEVNRPRIEELLTADRVALRQLITKGD
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtcgaaacggacactgagatccgcacaccgttcgagcaagaagtcgccgac
acacagcgatacttcgacagttcccgttttgccgggattgttcgcctctatacggcgcga
caagtcgtagagcagcgcggcacgattccgaacgactacaccgtcgcacgaaccgccgcg
ggcgtcttctaccagcgcctacgcgagctctacgccgagaagaagagcgtaaccaccttc
ggcccgtactcgccgggccaggccgtgagcatgaagcgcatgggcatcgaggcgatctac
ctaggcggatgggcgacctcggccaagggttccacgaccgaggatcccggacccgacctg
gccagctacccgctgagtcaggtgcccgacgatgcggcggtactggtacgcgccctgctt
accgccgaccgtaatcaggagtacctgcgcctgcagatgaccgaccagcagcgcgccacc
accacggcctacgattttcggcccttcatcatcgccgacgccgacaccggccacggcggt
gatccacacgtgcgcaacctcatccgccgcttcgtcgaggttggagtgcctggctaccac
atcgaggaccagcgcccgggcaccaagaagtgcggccaccaaggcggcaaggttctggtg
ccgtccgacgaacagatcaagcgcctcaacgccgctcgtttccagctcgacgtgatgcga
gtcccgggcatcatcgtcgcgcgcaccgatgccgaagcagccaatctgatcgacagccgc
gccgacgaacgggaccagcctttcctgctgggcgccaccaaactcgatatcccctcctac
aagtcctgcttcctggccatgctccggcgcttctacgaactgggcgtcaaggaactcaac
ggtcacctgctctacgctctcgccgatgccgagtacgccgccgccaacggctggctcgag
cgttccggcatcatgggcctgatctccgacgccgttaactcctggcgcgaagacgggatg
cagaccaccgacgaccttttcgaccaagtcgaatcccggttcgtggccgcgtgggaggac
gacgccggcctgatgacctatgcagaggccgtggccgaggtgctcgcgttcggtcaaagc
gaaggcgatccggtgccgatgagccccgaagaatggcggactttcgccgcgcgcgcatcg
ctttatgcggctcggcaaaaggcgaaggaaatgggcgtcgaccccggctgggactgcgag
ttggcaaaaacgccagaaggctactaccaaatccggggcggcataccgtatgcaatcgcc
aagtcgcttgcggcggcaccatttgccgacatcctctggatggagaccaagacggccgac
ctcgccgacgcgcggcagttcgccgaggcgatccatgccgagttcccggaccagatgttg
gcctacaacctctcgccgtcgttcaactgggataccaccggcatgaccgacgaggagatg
aaacgcttccccgaagagctgggcaagatgggcttcgtcttcaacttcatcacctacggt
gggcatcagatcgatggtgttgcctccgaagaattcgcaacggcgttgcgacaggacggc
atgctggcgctggctcggctgcagcgcaagatgcgcctcgtcgagtccccttatcgcaca
ccacagaccctggtcgccggcccgcgcagcgatgctgcgctgcaagcctcgtccggacgc
acggcgactaccaaggcgatgggcaagggctccacacagcaccaacatctcgtgcagacc
gaggtgcccaagaagctgctggaggagcggctggcgctgtggagcgatcactaccagctg
ggcgaaaagctgcgcgtccagctgcggcctcgccgcgccggctccgacgtgctggaactg
ggaatctacggcaacgacgacgaacagttggccaacgtcgtgttcgatcccatcaaggac
cgccacggccgcagcattctcaccgtgcgtgaccagaacacgttcgctcacaagcttcgc
cagaagcggctgatgaccttgatccacctctggctggtccaccggttcaaggctgacgcg
gtctactacgtcacgcctaccgaagacaaccagtatcaaacctcgaagatgaagtcgcat
gggatcttcagcgaggtcaaccaggacgtgggcgagatcattgtcgcggaggtcaaccgc
ccgcgcatcgaggagttgctgacggcggaccgggtggcgctgcgacagttgatcaccaag
ggcgactag

DBGET integrated database retrieval system