KEGG   Mycobacterium ulcerans: MUL_2965Help
Entry
MUL_2965          CDS       T00435                                 

Gene name
adhC
Definition
NADP-dependent alcohol dehydrogenase AdhC
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MUL_2965 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_2965 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_2965 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUL_2965 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MUL_2965 (adhC)
   00626 Naphthalene degradation
    MUL_2965 (adhC)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MUL_2965 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3288017..3289030
Genome map
AA seq 337 aa AA seqDB search
MATHKAVQIGAAGGPLQLVDVDTAPPADGEVRISVSACGICGTDRAFVHGAFPGLDWPLT
PGHEIAGRIAEIGNGVEDFAVGDRVAVGWFGGNCNHCDPCRKGMFIHCSKMKVPGWQYPG
GYAESVTVPATALARIPAELSDAEAAPMGCAGVTTYNALRHTRARPGDRVAVLGVGGLGH
LGLQFCRAMGFETVAIARGSAKAEDARQLGAHHYIDSTTGDVAEGLRRIGGAAVVLATAG
NSAAMAETVGGLLPRGELVVIGVTADPLPISPVQLINPGLSVTGHPSGTAKDVEDTMHFA
VLSGVRAWIEERPLAQAADGYEAMEQGRTRYRTVLAM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccacaaagctgtccaaattggtgcggcgggcgggcccctacagctggttgat
gtcgatactgctccgccggctgatggcgaggtgcgtatatcagtttctgcgtgtggtatt
tgcggcaccgaccgggcatttgtgcacggggcctttccaggcctggactggccgctgacg
cctggacacgaaatcgccggaagaatagccgaaatcggaaatggggttgaggatttcgca
gttggcgaccgcgtcgctgtcggttggttcggcggaaactgtaaccactgcgatccctgc
cgcaagggaatgttcatccactgctccaagatgaaggttccaggctggcagtatcccggt
ggctatgcggaatcggtgacggtgccggccaccgcgctggctcgcattccggcagagctc
tccgacgccgaggcggctccaatgggttgcgccggcgtcacgacgtacaacgcgttgcgt
cacacccgggcacggccgggcgatcgggtggcggtgctcggtgtcggaggtctgggccat
ctggggctacagttctgtcgtgccatgggttttgagactgtggcgatcgctcgcggtagt
gccaaggccgaggatgcacgccagctgggagcccaccattacatcgattccaccacaggt
gacgtagcggaaggattgcgacggatcggcggtgccgcggtcgtgttggcgaccgctggc
aattcggcagctatggctgaaacggtgggcggacttcttccccgcggcgagctggtcgtc
atcggcgtgacggctgatccgctaccgatcagcccggtccagctgatcaaccccggcctc
agcgtcacgggtcacccatccggtaccgctaaagacgtggaggacaccatgcatttcgcg
gtcttgtccggtgtgcgggcctggatcgaagagcgaccgctcgcgcaggccgccgatggc
tatgaggcgatggagcaaggccggacgcgctatcgcacggtcctggccatgtaa

DBGET integrated database retrieval system