KEGG   Mycobacterium ulcerans: MUL_2965Help
Entry
MUL_2965          CDS       T00435                                 

Gene name
adhC
Definition
(GenBank) NADP-dependent alcohol dehydrogenase AdhC
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00010  Glycolysis / Gluconeogenesis
mul00071  Fatty acid degradation
mul00350  Tyrosine metabolism
mul00625  Chloroalkane and chloroalkene degradation
mul00626  Naphthalene degradation
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_2965 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_2965 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUL_2965 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MUL_2965 (adhC)
   00626 Naphthalene degradation
    MUL_2965 (adhC)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MUL_2965 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABL05225
Pasteur: MUL_2965
UniProt: A0PSA6
Position
3288017..3289030
Genome map
AA seq 337 aa AA seqDB search
MATHKAVQIGAAGGPLQLVDVDTAPPADGEVRISVSACGICGTDRAFVHGAFPGLDWPLT
PGHEIAGRIAEIGNGVEDFAVGDRVAVGWFGGNCNHCDPCRKGMFIHCSKMKVPGWQYPG
GYAESVTVPATALARIPAELSDAEAAPMGCAGVTTYNALRHTRARPGDRVAVLGVGGLGH
LGLQFCRAMGFETVAIARGSAKAEDARQLGAHHYIDSTTGDVAEGLRRIGGAAVVLATAG
NSAAMAETVGGLLPRGELVVIGVTADPLPISPVQLINPGLSVTGHPSGTAKDVEDTMHFA
VLSGVRAWIEERPLAQAADGYEAMEQGRTRYRTVLAM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccacaaagctgtccaaattggtgcggcgggcgggcccctacagctggttgat
gtcgatactgctccgccggctgatggcgaggtgcgtatatcagtttctgcgtgtggtatt
tgcggcaccgaccgggcatttgtgcacggggcctttccaggcctggactggccgctgacg
cctggacacgaaatcgccggaagaatagccgaaatcggaaatggggttgaggatttcgca
gttggcgaccgcgtcgctgtcggttggttcggcggaaactgtaaccactgcgatccctgc
cgcaagggaatgttcatccactgctccaagatgaaggttccaggctggcagtatcccggt
ggctatgcggaatcggtgacggtgccggccaccgcgctggctcgcattccggcagagctc
tccgacgccgaggcggctccaatgggttgcgccggcgtcacgacgtacaacgcgttgcgt
cacacccgggcacggccgggcgatcgggtggcggtgctcggtgtcggaggtctgggccat
ctggggctacagttctgtcgtgccatgggttttgagactgtggcgatcgctcgcggtagt
gccaaggccgaggatgcacgccagctgggagcccaccattacatcgattccaccacaggt
gacgtagcggaaggattgcgacggatcggcggtgccgcggtcgtgttggcgaccgctggc
aattcggcagctatggctgaaacggtgggcggacttcttccccgcggcgagctggtcgtc
atcggcgtgacggctgatccgctaccgatcagcccggtccagctgatcaaccccggcctc
agcgtcacgggtcacccatccggtaccgctaaagacgtggaggacaccatgcatttcgcg
gtcttgtccggtgtgcgggcctggatcgaagagcgaccgctcgcgcaggccgccgatggc
tatgaggcgatggagcaaggccggacgcgctatcgcacggtcctggccatgtaa

DBGET integrated database retrieval system